GPR161 Antibody (1B2) - Azide and BSA Free

Sandwich ELISA: GPR161 Antibody (1B2) [H00023432-M01] - Detection limit for recombinant GST tagged GPR161 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1B2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GPR161 Antibody (1B2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse GPR161 Antibody (1B2) - Azide and BSA Free (H00023432-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: GPR161 (NP_722561.1, 362 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD
• Specificity: Reacts with G protein-coupled receptor 161.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GPR161
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Sandwich ELISA
  • Western Blot 1:100-1:2000
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GPR161 Antibody (1B2) - Azide and BSA Free

• FLJ33952
• G protein-coupled receptor 161
• Gm208
• GPR161
• G-protein coupled receptor 161
• G-protein coupled receptor RE2
• RE2

Background

Upon ligand binding, G protein-coupled receptors, such as GPR161, activate cytoplasmic G proteins (see GNAS, MIM 139320), allowing the receptors to transduce extracellular signals across the plasma membrane into the cell. Phosphorylation of the receptor attenuates signaling (Matteson et al., 2008 [PubMed 18250320]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for GPR161 Antibody (H00023432-M01). (Showing 1 - 1 of 1 FAQ).

1. Can your GPR161 antibody 1B2 (H00023432-M01) be used for live cell flow cytometry?
   • We have not tested this antibody for use in Flow cytometry.

Bioinformatics

• Gene Symbol: GPR161
• Entrez:
  • 23432(Human)
• Uniprot:
  • NP_722561()