![Western Blot: GPR150 Antibody [NBP2-85005] - WB Suggested Anti-GPR150 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell](http://images.novusbio.com/fullsize/GPR150-Antibody-Western-Blot-NBP2-85005-img0001.jpg "Western Blot: GPR150 Antibody [NBP2-85005] - WB Suggested Anti-GPR150 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit GPR150 Antibody - BSA Free (NBP2-85005) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of GPR150. Peptide sequence: SALNPFVYLFFQAGDCRLRRQLRKRLGSLCCAPQGGAEDEEGPRGHQALY The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GPR150 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GPR150 Antibody (NBP2-85005)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GPR150 |
![Immunocytochemistry Integrin alpha 8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_8_AF4076_Immunocytochemistry__Immunofluorescence_17437.jpg)
![Western Blot Integrin alpha 8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_8_AF4076_Western_Blot_20029.jpg)
![Simple Western Integrin alpha 8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_8_AF4076_Simple_Western_20113.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
