PRTFDC1 Antibody

Images

 
Western Blot: PRTFDC1 Antibody [NBP1-83261] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: PRTFDC1 Antibody [NBP1-83261] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: PRTFDC1 Antibody [NBP1-83261] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRTFDC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRTFDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRTFDC1 Protein (NBP1-83261PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRTFDC1 Antibody

  • EC 2.4.2.8
  • FLJ11888
  • HHGPEC 2.4.2
  • phosphoribosyl transferase domain containing 1
  • phosphoribosyltransferase domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
AF4076
Species: Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP2-55699
Species: Hu
Applications: WB, ICC/IF
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-87287
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PRTFDC1 Antibody (NBP1-83261) (0)

There are no publications for PRTFDC1 Antibody (NBP1-83261).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRTFDC1 Antibody (NBP1-83261) (0)

There are no reviews for PRTFDC1 Antibody (NBP1-83261). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRTFDC1 Antibody (NBP1-83261) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRTFDC1 Products

Bioinformatics Tool for PRTFDC1 Antibody (NBP1-83261)

Discover related pathways, diseases and genes to PRTFDC1 Antibody (NBP1-83261). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRTFDC1 Antibody (NBP1-83261)

Discover more about diseases related to PRTFDC1 Antibody (NBP1-83261).
 

Pathways for PRTFDC1 Antibody (NBP1-83261)

View related products by pathway.

PTMs for PRTFDC1 Antibody (NBP1-83261)

Learn more about PTMs related to PRTFDC1 Antibody (NBP1-83261).
 

Research Areas for PRTFDC1 Antibody (NBP1-83261)

Find related products by research area.

Blogs on PRTFDC1

There are no specific blogs for PRTFDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRTFDC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRTFDC1