Recombinant Human GOLPH4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GOLPH4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 473-568 of Human GOLPH4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GOLIM4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GOLPH4 Protein

  • GIMPc
  • GIMPCcis
  • golgi integral membrane protein 4
  • Golgi phosphoprotein 4130 kDa golgi-localized phosphoprotein
  • Golgi phosphoprotein of 130 kDa
  • GPP130Golgi-localized phosphoprotein of 130 kDa

Background

GOLPH4 - golgi phosphoprotein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-50627
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-91937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83352
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-15937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81414
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-94105
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88946
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GOLPH4 Partial Recombinant Protein (H00027333-Q01) (0)

There are no publications for GOLPH4 Partial Recombinant Protein (H00027333-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GOLPH4 Partial Recombinant Protein (H00027333-Q01) (0)

There are no reviews for GOLPH4 Partial Recombinant Protein (H00027333-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GOLPH4 Partial Recombinant Protein (H00027333-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GOLPH4 Products

Bioinformatics Tool for GOLPH4 Partial Recombinant Protein (H00027333-Q01)

Discover related pathways, diseases and genes to GOLPH4 Partial Recombinant Protein (H00027333-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLPH4 Partial Recombinant Protein (H00027333-Q01)

Discover more about diseases related to GOLPH4 Partial Recombinant Protein (H00027333-Q01).
 

Pathways for GOLPH4 Partial Recombinant Protein (H00027333-Q01)

View related products by pathway.

PTMs for GOLPH4 Partial Recombinant Protein (H00027333-Q01)

Learn more about PTMs related to GOLPH4 Partial Recombinant Protein (H00027333-Q01).
 

Research Areas for GOLPH4 Partial Recombinant Protein (H00027333-Q01)

Find related products by research area.

Blogs on GOLPH4

There are no specific blogs for GOLPH4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GOLPH4 Antibody
NBP1-91954

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GOLPH4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLIM4