Home » GOLGA5 » GOLGA5 Proteins » GOLGA5 Recombinant Protein Antigen

GOLGA5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GOLGA5 Protein (NBP2-39007PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

GOLGA5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GOLGA5.

Source: E.coli

Amino Acid Sequence: QEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNS
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GOLGA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-39007.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GOLGA5 Recombinant Protein Antigen

  • Cell proliferation-inducing gene 31 protein
  • golgi autoantigen, golgin subfamily a, 5
  • golgin A5
  • Golgin subfamily A member 5
  • Golgin-84
  • GOLIM5
  • Protein Ret-II
  • PTC5
  • RET-fused gene 5 protein
  • RETII
  • ret-II
  • rfg5
  • RFG5golgi integral membrane protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of CUX1 expression in transfected 293T cell line by CUTL1 monoclonal antibody (M01), clone 2A10.Lane 1: CUX1 transfected lysate(77.2 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of monoclonal antibody to CUTL1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of monoclonal antibody to CUTL1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. Antibody concentration 5 ug/ml.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
GOLGB1/Giantin
Antibody
NBP2-22321
Western Blot: GOLGB1/Giantin Antibody [NBP2-22321] - HeLa cell lysate sample treated with DMSO was run on 8% SDS-PAGE. Both giantin monomer and dimer are indicated. Western blot image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: GOLGB1/Giantin Antibody [NBP2-22321] - PC-3 human prostate cancer cell line. Image was captured using EVOS M5000 microscope. Red - giantin; blue - nucleus, DAPI; bar 40 micron. ICC/IF image submitted by a verified customer review.
Western Blot: GOLGB1/Giantin Antibody [NBP2-22321] - Whole cell lysate (50 ug) from 293T, HeLa, and Jurkat cells. NBP2-22321 used for WB at 0.1 ug/mL. Detection: Chemiluminescence with an exposure time of 10 seconds.
(2 Reviews)
(5 Publications)
Species: Hu
Applications: WB, ICC/IF, IP
Ret Antibody
[Unconjugated]
AF482
Ret was detected in perfusion fixed frozen sections of mouse spinal cord using Goat Anti-Mouse Ret Antigen Affinity-purified Polyclonal Antibody (Catalog # AF482) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to the ventral horn. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(26 Publications)
Species: Mu
Applications: WB, IHC
GM130/GOLGA2
Antibody
NBP2-53420
Immunocytochemistry/Immunofluorescence: GM130/GOLGA2 Antibody [NBP2-53420] - HeLa cells were fixed for 10 min using 10% formalin and then permeabilized for 5 min using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-GOLGA2 at 1:200 overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at 1:500. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at 1:1000 and detected with an anti-mouse DyLight 550 (Red) at 1:500. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: GM130/GOLGA2 Antibody [NBP2-53420] - Total protein from human HeLa and mouse Neuro2A cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 0.5 ug/mL anti-GOLGA2 in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP2-53420] - Analysis of a FFPE tissue section of mouse intesting using GM130/GOLGA2 antibody at 1:1500. The antibody generated staining in the the Golgi apparatus in the perinuclear region.
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CRTAP Antibody
(4D9)
H00010491-M01
Western Blot: CRTAP Antibody (4D9) [H00010491-M01] - CRTAP monoclonal antibody (M01), clone 4D9 Analysis of CRTAP expression in HeLa.
Immunohistochemistry-Paraffin: CRTAP Antibody (4D9) [H00010491-M01] - Analysis of monoclonal antibody to CRTAP on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Sandwich ELISA: CRTAP Antibody (4D9) [H00010491-M01] - Detection limit for recombinant GST tagged CRTAP is approximately 0.03ng/ml as a capture antibody.
(3 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Raf-1 Antibody
(563002)
MAB4540
Western blot shows lysates of MCF‑7 human breast cancer cell line, HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, L‑929 mouse fibroblast cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Raf‑1 at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Raf‑1 was detected in immersion fixed paraffin-embedded sections of human liver array using Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC
CYTIP Antibody
NB100-1002
Western Blot: CYTIP Antibody [NB100-1002] - Staining of Jurkat (A) and (1 ug/mL) MOLT4 (B) cell lysate (35 ug protein in RIPA buffer). Antibody at 0.5 ug/mL. Detected by chemiluminescence.
Immunofluorescence: CYTIP Antibody [NB100-1002] - Analysis of paraformaldehyde fixed A431 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic and nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunofluorescence: CYTIP Antibody [NB100-1002] - Analysis of paraformaldehyde fixed U251 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing strong cytoplasmic and weak nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(1 Publication)
Species: Hu
Applications: WB, PEP-ELISA, IF
GOLPH3 Antibody
NBP2-75515
Immunocytochemistry/Immunofluorescence: GOLPH3 Antibody [NBP2-75515] - Staining GOLPH3 in SK-Br-3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: GOLPH3 Antibody [NBP2-75515] - Analysis of paraffin-embedded mouse stomach tissue using anti-GOLPH3 antibody. Counter stained with hematoxylin.
Flow Cytometry: GOLPH3 Antibody [NBP2-75515] - Analysis of Hela cells with GOLPH3 antibody at 1/100 dilution (green) compared with an unlabelled control (cells without incubation with primary antibody; red).
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
ARHGAP4 Antibody
NBP1-88527
Western Blot: ARHGAP4 Antibody [NBP1-88527] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human colon.
Western Blot: ARHGAP4 Antibody [NBP1-88527] - Analysis in human cell line RPMI-8226.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
VDP p115 Antibody
(3F4)
H00008615-M03
Western Blot: VDP p115 Antibody (3F4) [H00008615-M03] - Analysis of USO1 expression in HeLa (Cat # L013V1).
Immunocytochemistry/Immunofluorescence: VDP p115 Antibody (3F4) [H00008615-M03] - Analysis of monoclonal antibody to USO1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: VDP p115 Antibody (3F4) [H00008615-M03] - Analysis of monoclonal antibody to USO1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
OCRL Antibody
NBP1-80973
Western Blot: OCRL Antibody [NBP1-80973] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-OCRL antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: OCRL Antibody [NBP1-80973] - Staining of human Fallopian tube shows moderate to strong cytoplasmic and membranous positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, KD
NCOA4 Antibody
(1B7)
H00008031-M04
Western Blot: NCOA4 Antibody (1B7) [H00008031-M04] - Analysis of NCOA4 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/Immunofluorescence: NCOA4 Antibody (1B7) [H00008031-M04] - Analysis of monoclonal antibody to NCOA4 on NIH/3T3 cell. Antibody concentration 10 ug/ml
ELISA: NCOA4 Antibody (1B7) [H00008031-M04] - Detection limit for recombinant GST tagged NCOA4 is approximately 3ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Rab1A Antibody
NBP1-55113
Western Blot: Rab1A Antibody [NBP1-55113] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle
Immunohistochemistry: Rab1A Antibody [NBP1-55113] - Formalin Fixed Paraffin Embedded Human Bronchial Epithelial Tissue. Observed Staining: Cytoplasmic staining with Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.
Western Blot: Rab1A Antibody [NBP1-55113] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
RAB6A Antibody
NBP1-33110
Knockout Validated: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RAB6A Antibody [NBP1-33110] - A549 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RAB6A protein stained by RAB6A antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
GOLPH4 Antibody
NBP1-91954
Immunocytochemistry/Immunofluorescence: GOLPH4 Antibody [NBP1-91954] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91954] - Staining of human liver.
Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91954] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Patched 1/PTCH
Antibody
NBP1-71662
Western Blot: Patched 1/PTCH Antibody [NBP1-71662] - Analysis of Patched 1 in human skeletal muscle protein.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody [NBP1-71662] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse lung using 1:50 dilution of PTCH antibody with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a specific membrane-cytoplasmic staining in bronchiolar and alveolar epithelial cells with stronger signal towards the membranes of the cells.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody [NBP1-71662] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse lung using 1:50 dilution of PTCH antibody with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a specific membrane-cytoplasmic staining in bronchiolar and alveolar epithelial cells with stronger signal towards the membranes of the cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Western Blot: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - A. 30 ug Neuro2A whole cell lysate/extract. B. 30 ug GL261 whole cell lysate/extract. C. 30 ug C8D30 whole cell lysate/extract. D. 30 ug NIH-3T3 whole cell lysate/extract. E. 30 ug BCL-1 whole cell lysate/extract. F. 30 ug Raw264.7 whole cell lysate/extract. G. 30 ug C2C12 whole cell lysate/extract.
Immunocytochemistry/Immunofluorescence: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraffin-embedded OVCAR3 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CCDC6 Antibody
NBP1-85351
Western Blot: CCDC6 Antibody [NBP1-85351] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: CCDC6 Antibody [NBP1-85351] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human liver shows no positivity in hepatocytes as expected.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - miRNA-768-3p specifically targets K-ras. Effect of miRNA inhibitors that were reduced by co-culture on the level of pan-RAS, phospho-B-Raf and CD44 and pan-Akt by western blotting. Also shown is the effect of different miRNA inhibitors on the level of K-ras in H520 cells by western blot. Cropped blots are shown and were run under the same experimental conditions. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep02392), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: KRAS Antibody (3B10-2F2) [H00003845-M01] - Analysis of monoclonal antibody to KRAS on HeLa cell. Antibody concentration 10 ug/ml.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
TrkA Antibody
[Unconjugated]
AF175
Western blot shows lysates of RPMI 8226 human multiple myeloma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human TrkA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF175) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for TrkA at approximately 140 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
TrkA was detected in immersion fixed paraffin-embedded sections of human colon using Goat Anti-Human TrkA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF175) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in colon glands. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human beta ‑NGF (Catalog # 256-GF) stimulates proliferation in the TF‑1 human erythroleukemic cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human beta ‑NGF (5 ng/mL) is neutralized (green line) by increasing concent­rations of Goat Anti-Human TrkA Antigen Affinity-purified Poly­clonal Antibody (Catalog # AF175). The ND50 is typically3‑12 µg/mL.
(1 Review)
(9 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut

Publications for GOLGA5 Protein (NBP2-39007PEP) (0)

There are no publications for GOLGA5 Protein (NBP2-39007PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GOLGA5 Protein (NBP2-39007PEP) (0)

There are no reviews for GOLGA5 Protein (NBP2-39007PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GOLGA5 Protein (NBP2-39007PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional GOLGA5 Products

Bioinformatics Tool for GOLGA5 Protein (NBP2-39007PEP)

Discover related pathways, diseases and genes to GOLGA5 Protein (NBP2-39007PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLGA5 Protein (NBP2-39007PEP)

Discover more about diseases related to GOLGA5 Protein (NBP2-39007PEP).
 

Pathways for GOLGA5 Protein (NBP2-39007PEP)

View related products by pathway.

PTMs for GOLGA5 Protein (NBP2-39007PEP)

Learn more about PTMs related to GOLGA5 Protein (NBP2-39007PEP).
 

Research Areas for GOLGA5 Protein (NBP2-39007PEP)

Find related products by research area.

Blogs on GOLGA5

There are no specific blogs for GOLGA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
KRAS Antibody (3B10-2F2)
H00003845-M01

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GOLGA5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GOLGA5