We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GOLGA5 Recombinant Protein Antigen

Images

 
There are currently no images for GOLGA5 Protein (NBP2-39007PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GOLGA5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GOLGA5.

Source: E. coli

Amino Acid Sequence: QEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GOLGA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39007.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GOLGA5 Recombinant Protein Antigen

  • Cell proliferation-inducing gene 31 protein
  • golgi autoantigen, golgin subfamily a, 5
  • golgin A5
  • Golgin subfamily A member 5
  • Golgin-84
  • GOLIM5
  • Protein Ret-II
  • PTC5
  • RET-fused gene 5 protein
  • RETII
  • ret-II
  • rfg5
  • RFG5golgi integral membrane protein 5

Background

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-22321
Species: Hu
Applications: ICC/IF, IP, WB
AF482
Species: Mu
Applications: IHC, WB
NBP2-53420
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-94105
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB100-1002
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
NBP2-75515
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF,  IHC-P, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-38014
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-80973
Species: Hu
Applications: IHC,  IHC-P, KD, WB
H00008031-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-55113
Species: Hu, Pm, Mu
Applications: IHC,  IHC-P, WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-91954
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB41051
Species: Hu, Mu
Applications: WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85351
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
AF1056
Species: Rt
Applications: IHC, WB

Publications for GOLGA5 Protein (NBP2-39007PEP) (0)

There are no publications for GOLGA5 Protein (NBP2-39007PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GOLGA5 Protein (NBP2-39007PEP) (0)

There are no reviews for GOLGA5 Protein (NBP2-39007PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GOLGA5 Protein (NBP2-39007PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GOLGA5 Products

Research Areas for GOLGA5 Protein (NBP2-39007PEP)

Find related products by research area.

Blogs on GOLGA5

There are no specific blogs for GOLGA5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GOLGA5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLGA5