Recombinant Human GNG5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GNG5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-68 of Human GNG5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GNG5
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GNG5 Protein

  • FLJ92393
  • GNGT5
  • guanine nucleotide binding protein (G protein), gamma 5
  • guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5

Background

GNG5( AAH03563, 1 a.a. - 69 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80901
Species: Hu
Applications: IHC, IHC-P
NBP1-47836
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81811
Species: Hu
Applications: IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-16699
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-38953
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5128
Species: Hu, Mu, Rt
Applications: WB
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30380
Species: Hu
Applications: IHC, IHC-P
NBP1-90278
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
H00002787-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for GNG5 Recombinant Protein (H00002787-P01) (0)

There are no publications for GNG5 Recombinant Protein (H00002787-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNG5 Recombinant Protein (H00002787-P01) (0)

There are no reviews for GNG5 Recombinant Protein (H00002787-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNG5 Recombinant Protein (H00002787-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GNG5 Products

Bioinformatics Tool for GNG5 Recombinant Protein (H00002787-P01)

Discover related pathways, diseases and genes to GNG5 Recombinant Protein (H00002787-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNG5 Recombinant Protein (H00002787-P01)

Discover more about diseases related to GNG5 Recombinant Protein (H00002787-P01).
 

Pathways for GNG5 Recombinant Protein (H00002787-P01)

View related products by pathway.

Research Areas for GNG5 Recombinant Protein (H00002787-P01)

Find related products by research area.

Blogs on GNG5

There are no specific blogs for GNG5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GNG5 Antibody
NBP2-14061

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GNG5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GNG5