Glypican 1 Antibody

Product Discontinued

Glypican 1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%). Rat, Human reactivity reported in scientific literature (PMID: 24937430).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Glypican 1 Antibody

• FLJ38078
• Glypican 1
• glypican proteoglycan 1
• glypican
• glypican-1
• GPC1

Background

GPC1(Glypican 1) is a cell surface proteoglycan that contains heparan sulphate. The protein is attached to the cell membrane by a GPI anchor. GPC1 is required for efficient TGF-beta1 signaling in pancreatic cancer cells. Members of the glypican-related integral membrane proteoglycan family (GRIPS) may play a role in the control of cell division and growth regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glypican 1 Antibody (NBP1-89759)(2)

Publications using NBP1-89759

• Tanaka M, Ishikawa S, Ushiku T et al. EVI1 modulates oncogenic role of GPC1 in pancreatic carcinogenesis. Oncotarget 2017-11-21 [PMID: 29245923] (IF/IHC, Human)
• Knelson EH, Gaviglio AL, Nee JC et al. Stromal heparan sulfate differentiates neuroblasts to suppress neuroblastoma growth. J Clin Invest 2014-07-01 [PMID: 24937430] (IF/IHC, WB, Human, Rat)

Bioinformatics

• Gene Symbol: GPC1