Glypican 1 Antibody


Western Blot: Glypican 1 Antibody [NBP1-89759] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: Glypican 1 Antibody [NBP1-89759] - Staining of human cell line HaCaT shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Glypican 1 Antibody [NBP1-89759] - Staining in human skin and liver tissues. Corresponding GPC1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Glypican 1 Antibody [NBP1-89759] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in astrocytes.
Immunohistochemistry-Paraffin: Glypican 1 Antibody [NBP1-89759] - Staining of human kidney shows moderate cytoplasmic positivity in subsets of tubules.
Immunohistochemistry-Paraffin: Glypican 1 Antibody [NBP1-89759] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Glypican 1 Antibody [NBP1-89759] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Glypican 1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRR
Specificity of human, rat Glypican 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glypican 1 Protein (NBP1-89759PEP)
Read Publications using
NBP1-89759 in the following applications:

  • IHC
    2 publications
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%). Rat, Human reactivity reported in scientific literature (PMID: 24937430).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Glypican 1 Antibody

  • FLJ38078
  • Glypican 1
  • glypican proteoglycan 1
  • glypican
  • glypican-1
  • GPC1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Glypican 1 Antibody (NBP1-89759)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Glypican 1 Antibody (NBP1-89759) (0)

There are no reviews for Glypican 1 Antibody (NBP1-89759). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glypican 1 Antibody (NBP1-89759) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Glypican 1 Products

Bioinformatics Tool for Glypican 1 Antibody (NBP1-89759)

Discover related pathways, diseases and genes to Glypican 1 Antibody (NBP1-89759). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glypican 1 Antibody (NBP1-89759)

Discover more about diseases related to Glypican 1 Antibody (NBP1-89759).

Pathways for Glypican 1 Antibody (NBP1-89759)

View related products by pathway.

PTMs for Glypican 1 Antibody (NBP1-89759)

Learn more about PTMs related to Glypican 1 Antibody (NBP1-89759).

Blogs on Glypican 1

There are no specific blogs for Glypican 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Glypican 1 Antibody and receive a gift card or discount.


Gene Symbol GPC1