Glypican 1 Antibody

Images

 
Western Blot: Glypican 1 Antibody [NBP1-89759] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: Glypican 1 Antibody [NBP1-89759] - Staining of human cell line HaCaT shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Glypican 1 Antibody [NBP1-89759] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Glypican 1 Antibody [NBP1-89759] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: Glypican 1 Antibody [NBP1-89759] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in astrocytes.
Immunohistochemistry-Paraffin: Glypican 1 Antibody [NBP1-89759] - Staining of human kidney shows moderate cytoplasmic positivity in subsets of tubules.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glypican 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glypican 1 Protein (NBP1-89759PEP)
Publications
Read Publication using
NBP1-89759 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%). Rat, Human reactivity reported in scientific literature (PMID: 24937430).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glypican 1 Antibody

  • FLJ38078
  • Glypican 1
  • glypican proteoglycan 1
  • glypican
  • glypican-1
  • GPC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF2918
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF2119
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF2364
Species: Hu
Applications: WB, IHC
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-49892
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00054957-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57016
Species: Hu
Applications: WB
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Glypican 1 Antibody (NBP1-89759)(1)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for Glypican 1 Antibody (NBP1-89759) (0)

There are no reviews for Glypican 1 Antibody (NBP1-89759). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glypican 1 Antibody (NBP1-89759) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glypican 1 Products

Bioinformatics Tool for Glypican 1 Antibody (NBP1-89759)

Discover related pathways, diseases and genes to Glypican 1 Antibody (NBP1-89759). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glypican 1 Antibody (NBP1-89759)

Discover more about diseases related to Glypican 1 Antibody (NBP1-89759).
 

Pathways for Glypican 1 Antibody (NBP1-89759)

View related products by pathway.

PTMs for Glypican 1 Antibody (NBP1-89759)

Learn more about PTMs related to Glypican 1 Antibody (NBP1-89759).

Blogs on Glypican 1

There are no specific blogs for Glypican 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glypican 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPC1
Entrez