GLYATL2 Antibody

Images

 
Western Blot: GLYATL2 Antibody [NBP1-54782] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLYATL2 Antibody Summary

Immunogen
Synthetic peptides corresponding to GLYATL2(glycine-N-acyltransferase-like 2) The peptide sequence was selected from the middle region of GLYATL2. Peptide sequence LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLYATL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GLYATL2 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GLYATL2 Antibody

  • Acyl-CoA:glycine N-acyltransferase-like protein 2
  • BXMAS2-10
  • EC 2.3.1.13
  • GATF-B
  • glycine acyltransferase family-B
  • glycine N-acyltransferase-like protein 2
  • glycine-N-acyltransferase-like 2
  • MGC24009

Background

GLYATL2 belongs to the glycine N-acyltransferase family. GLYATL2 is a mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. It can conjugate a multitude of substrates to form a variety of N-acylglycines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
AF7320
Species: Mu
Applications: WB
NBP2-55197
Species: Hu
Applications: ICC/IF
NBP1-32600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81310
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-49242
Species: Hu
Applications: WB, IHC, IHC-P
NLS830
Species: Hu, Po, Bt, Ca, Eq, Pm, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-67375
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-82024
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-28868
Species: Hu
Applications: WB, ELISA
NBP3-03109
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-84128
Species: Hu
Applications: WB
NBP1-43333
Species: Mu
Applications: WB
NBP2-12893
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
H00003109-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for GLYATL2 Antibody (NBP1-54782) (0)

There are no publications for GLYATL2 Antibody (NBP1-54782).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLYATL2 Antibody (NBP1-54782) (0)

There are no reviews for GLYATL2 Antibody (NBP1-54782). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLYATL2 Antibody (NBP1-54782) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GLYATL2 Products

Bioinformatics Tool for GLYATL2 Antibody (NBP1-54782)

Discover related pathways, diseases and genes to GLYATL2 Antibody (NBP1-54782). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLYATL2 Antibody (NBP1-54782)

Discover more about diseases related to GLYATL2 Antibody (NBP1-54782).
 

Pathways for GLYATL2 Antibody (NBP1-54782)

View related products by pathway.

PTMs for GLYATL2 Antibody (NBP1-54782)

Learn more about PTMs related to GLYATL2 Antibody (NBP1-54782).

Blogs on GLYATL2

There are no specific blogs for GLYATL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLYATL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLYATL2
Uniprot