Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6)

Images

 
Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [H00002950-M01] - Analysis of GSTP1 expression in transfected 293T cell line by GSTP1 monoclonal antibody (M01), clone 2G6-F6.Lane 1: GSTP1 ...read more
Immunocytochemistry/ Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [H00002950-M01] - Analysis of monoclonal antibody to GSTP1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunoprecipitation: Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [H00002950-M01] - Analysis of GSTP1 transfected lysate using anti-GSTP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP, S-ELISA
Clone
2G6-F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) Summary

Immunogen
GSTP1 (AAH10915, 1 a.a. ~ 210 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Specificity
GSTP1 - glutathione S-transferase pi
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GSTP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IF and ELISA.
Publications
Read Publications using H00002950-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6)

  • deafness, X-linked 7
  • DFN7
  • EC 2.5.1.18
  • FAEES3
  • fatty acid ethyl ester synthase III
  • glutathione S-transferase P
  • Glutathione STransferase pi 1
  • Glutathione S-Transferase pi 1
  • GST class-pi
  • GST3DFN7
  • GSTP
  • GSTP1
  • GSTP1-1
  • PI

Background

Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. The glutathione S-transferase pi gene (GSTP1) is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-326
Species: All-NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-35212
Species: Hu
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01)(3)


Reviews for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01) (0)

There are no reviews for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Glutathione S-Transferase pi 1/GSTP1 Products

Bioinformatics Tool for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01)

Discover related pathways, diseases and genes to Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01)

Discover more about diseases related to Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01).
 

Pathways for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01)

View related products by pathway.

PTMs for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01)

Learn more about PTMs related to Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01).
 

Research Areas for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01)

Find related products by research area.

Blogs on Glutathione S-Transferase pi 1/GSTP1

There are no specific blogs for Glutathione S-Transferase pi 1/GSTP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTP1
Entrez
OMIM
Uniprot