Glutathione S-transferase Mu 5 Antibody (1B3)

Images

 
Sandwich ELISA: Glutathione S-transferase Mu 5 Antibody (1B3) [H00002949-M01] - Detection limit for recombinant GST tagged GSTM5 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Glutathione S-transferase Mu 5 Antibody (1B3) Summary

Immunogen
GSTM5 (NP_000842 145 a.a. - 218 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
Specificity
GSTM5 (1B3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GSTM5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glutathione S-transferase Mu 5 Antibody (1B3)

  • EC 2.5.1.18
  • glutathione S-alkyltransferase M5
  • glutathione S-aralkyltransferase M5
  • glutathione S-aryltransferase M5
  • glutathione S-transferase M5
  • glutathione S-transferase mu 5
  • GST class-mu 5
  • GSTM5-5
  • GTM5
  • S-(hydroxyalkyl)glutathione lyase M5

Background

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
H00002948-T01
Species: Hu
NBP1-83323
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-54633
Species: Hu
Applications: WB, IHC
NBP2-57880
Species: Hu
Applications: ICC/IF
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-32157
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6487
Species: Hu
Applications: WB, ICC
H00009446-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA

Publications for Glutathione S-transferase Mu 5 Antibody (H00002949-M01) (0)

There are no publications for Glutathione S-transferase Mu 5 Antibody (H00002949-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutathione S-transferase Mu 5 Antibody (H00002949-M01) (0)

There are no reviews for Glutathione S-transferase Mu 5 Antibody (H00002949-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Glutathione S-transferase Mu 5 Antibody (H00002949-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glutathione S-transferase Mu 5 Products

Bioinformatics Tool for Glutathione S-transferase Mu 5 Antibody (H00002949-M01)

Discover related pathways, diseases and genes to Glutathione S-transferase Mu 5 Antibody (H00002949-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutathione S-transferase Mu 5 Antibody (H00002949-M01)

Discover more about diseases related to Glutathione S-transferase Mu 5 Antibody (H00002949-M01).
 

Pathways for Glutathione S-transferase Mu 5 Antibody (H00002949-M01)

View related products by pathway.

PTMs for Glutathione S-transferase Mu 5 Antibody (H00002949-M01)

Learn more about PTMs related to Glutathione S-transferase Mu 5 Antibody (H00002949-M01).

Blogs on Glutathione S-transferase Mu 5

There are no specific blogs for Glutathione S-transferase Mu 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutathione S-transferase Mu 5 Antibody (1B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTM5
Entrez
OMIM
Uniprot