Glucose Transporter GLUT6 Antibody [Biotin] Summary
| Immunogen |
Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6.
Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC2A6 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
PBS |
| Preservative |
0.05% Sodium Azide |
| Purity |
Protein A purified |
Alternate Names for Glucose Transporter GLUT6 Antibody [Biotin]
Background
Glucose transporters are integral membrane glycoproteins involved in transporting glucose into most cells. Seven types of glucose transport carrier proteins, designated as Glut 1 to 7, facilitate glucose transport across the cell membrane. Molecular cloning of glucose transporters have identified a family of closely related genes that encode at least 7 proteins exhibiting high degree of amino acid homology (45% to 65%), all in the molecular weight range of 40 to 60 kDa. Individual members of the Glut family have predicted secondary structure characteristic of 12 membrane spanning domains of other transport carriers. The majority of differences in sequence homology in Glut proteins occur at 4 hydrophilic domains that may play a role in distinct tissue specific pattern of expression and targeting. All Glut proteins are glycosylated at or near the C terminus and are present on either cell surface or in intracellular sites. Some transporters exhibit dynamic trafficking between intracellular storage sites and plasma membranes in response to various stimuli. In some tissues Glut proteins are asymmetrically distributed between apical and basolateral membranes as in blood brain barrier and blood testis barriers.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IHC-P, IP, WB
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Publications for Glucose Transporter GLUT6 Antibody (NBP1-59891B) (0)
There are no publications for Glucose Transporter GLUT6 Antibody (NBP1-59891B).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glucose Transporter GLUT6 Antibody (NBP1-59891B) (0)
There are no reviews for Glucose Transporter GLUT6 Antibody (NBP1-59891B).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Glucose Transporter GLUT6 Antibody (NBP1-59891B) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glucose Transporter GLUT6 Products
Blogs on Glucose Transporter GLUT6