Glucose Transporter GLUT6 Antibody [Alexa Fluor® 750] Summary
| Immunogen |
Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6.
Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC2A6 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Protein A purified |
Notes
Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for Glucose Transporter GLUT6 Antibody [Alexa Fluor® 750]
Background
Glucose transporters are integral membrane glycoproteins involved in transporting glucose into most cells. Seven types of glucose transport carrier proteins, designated as Glut 1 to 7, facilitate glucose transport across the cell membrane. Molecular cloning of glucose transporters have identified a family of closely related genes that encode at least 7 proteins exhibiting high degree of amino acid homology (45% to 65%), all in the molecular weight range of 40 to 60 kDa. Individual members of the Glut family have predicted secondary structure characteristic of 12 membrane spanning domains of other transport carriers. The majority of differences in sequence homology in Glut proteins occur at 4 hydrophilic domains that may play a role in distinct tissue specific pattern of expression and targeting. All Glut proteins are glycosylated at or near the C terminus and are present on either cell surface or in intracellular sites. Some transporters exhibit dynamic trafficking between intracellular storage sites and plasma membranes in response to various stimuli. In some tissues Glut proteins are asymmetrically distributed between apical and basolateral membranes as in blood brain barrier and blood testis barriers.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IHC-P, IP, WB
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Publications for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750) (0)
There are no publications for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750) (0)
There are no reviews for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glucose Transporter GLUT6 Products
Blogs on Glucose Transporter GLUT6