Glucose Transporter GLUT6 Antibody [Alexa Fluor® 750]

Images

 

Product Details

Summary
Product Discontinued
View other related Glucose Transporter GLUT6 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59891AF750
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Glucose Transporter GLUT6 Antibody [Alexa Fluor® 750] Summary

Immunogen
Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC2A6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Glucose Transporter GLUT6 Antibody [Alexa Fluor® 750]

  • Glucose transporter type 6
  • Glucose transporter type 9
  • GLUT6
  • GLUT-9
  • GLUT9GLUT-6
  • HSA011372
  • solute carrier family 2 (facilitated glucose transporter), member 6
  • solute carrier family 2, facilitated glucose transporter member 6

Background

Glucose transporters are integral membrane glycoproteins involved in transporting glucose into most cells. Seven types of glucose transport carrier proteins, designated as Glut 1 to 7, facilitate glucose transport across the cell membrane. Molecular cloning of glucose transporters have identified a family of closely related genes that encode at least 7 proteins exhibiting high degree of amino acid homology (45% to 65%), all in the molecular weight range of 40 to 60 kDa. Individual members of the Glut family have predicted secondary structure characteristic of 12 membrane spanning domains of other transport carriers. The majority of differences in sequence homology in Glut proteins occur at 4 hydrophilic domains that may play a role in distinct tissue specific pattern of expression and targeting. All Glut proteins are glycosylated at or near the C terminus and are present on either cell surface or in intracellular sites. Some transporters exhibit dynamic trafficking between intracellular storage sites and plasma membranes in response to various stimuli. In some tissues Glut proteins are asymmetrically distributed between apical and basolateral membranes as in blood brain barrier and blood testis barriers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05054
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
H00116085-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-59812
Species: Hu
Applications: WB
NBP3-12263
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF,  IHC-P, IP, WB
NBP1-47980
Species: Hu, Pm
Applications: Flow, IHC,  IHC-P, IP, WB
MAB1415
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-22218
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33382
Species: Hu
Applications: IHC,  IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB8398
Species: Hu
Applications: CyTOF-ready, Flow
NBP3-12262
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
H00010786-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB

Publications for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750) (0)

There are no publications for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750) (0)

There are no reviews for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucose Transporter GLUT6 Antibody [Alexa Fluor® 750] and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC2A6