Glucose Transporter GLUT6 Antibody [Alexa Fluor® 750]

Images

 
There are currently no images for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Alexa Fluor 750

Glucose Transporter GLUT6 Antibody [Alexa Fluor® 750] Summary

Immunogen
Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLT The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC2A6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Glucose Transporter GLUT6 Antibody [Alexa Fluor® 750]

  • Glucose transporter type 6
  • Glucose transporter type 9
  • GLUT6
  • GLUT-9
  • GLUT9GLUT-6
  • HSA011372
  • solute carrier family 2 (facilitated glucose transporter), member 6
  • solute carrier family 2, facilitated glucose transporter member 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05054
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
H00116085-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-59812
Species: Hu
Applications: WB
NBP1-91944
Species: Hu
Applications: IHC, IHC-P
NBP1-47980
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-66872
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33382
Species: Hu
Applications: IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB8398
Species: Hu
Applications: Flow, CyTOF-ready
NB100-490
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-94745
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
NBP1-59891AF750
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750) (0)

There are no publications for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750) (0)

There are no reviews for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Alexa Fluor 350 NBP1-59891AF350
Alexa Fluor 405 NBP1-59891AF405
Alexa Fluor 488 NBP1-59891AF488
Alexa Fluor 532 NBP1-59891AF532
Alexa Fluor 594 NBP1-59891AF594
Alexa Fluor 647 NBP1-59891AF647
Alexa Fluor 700 NBP1-59891AF700
Alexa Fluor 750 NBP1-59891AF750
DyLight 350 NBP1-59891UV
DyLight 405 NBP1-59891V
DyLight 488 NBP1-59891G
DyLight 550 NBP1-59891R
DyLight 594 NBP1-59891DL594
DyLight 680 NBP1-59891FR
DyLight 755 NBP1-59891IR

Additional Glucose Transporter GLUT6 Products

Bioinformatics Tool for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750)

Discover related pathways, diseases and genes to Glucose Transporter GLUT6 Antibody (NBP1-59891AF750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750)

Discover more about diseases related to Glucose Transporter GLUT6 Antibody (NBP1-59891AF750).
 

Pathways for Glucose Transporter GLUT6 Antibody (NBP1-59891AF750)

View related products by pathway.

Blogs on Glucose Transporter GLUT6

There are no specific blogs for Glucose Transporter GLUT6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucose Transporter GLUT6 Antibody [Alexa Fluor® 750] and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC2A6