Glucagon Antibody (2D3-2B11)

Images

 
Western Blot: Glucagon Antibody (2D3-2B11) [H00002641-M01] - Analysis of GCG expression in transfected 293T cell line by GCG monoclonal antibody (M01), clone 2D3-2B11.Lane 1: GCG transfected lysate(20.9 KDa).Lane 2: ...read more
ELISA: Glucagon Antibody (2D3-2B11) [H00002641-M01] - Detection limit for recombinant GST tagged GCG is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D3-2B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Glucagon Antibody (2D3-2B11) Summary

Immunogen
GCG (AAH05278, 1 a.a. - 180 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Specificity
GCG - glucagon
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GCG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glucagon Antibody (2D3-2B11)

  • GCG
  • glicentin-related polypeptide
  • Glucagon
  • GRPP

Background

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
MAB8864
Species: Hu
Applications: IHC
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48988
Species: Hu
Applications: IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-89771
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3145
Species: Hu
Applications: WB
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for Glucagon Antibody (H00002641-M01) (0)

There are no publications for Glucagon Antibody (H00002641-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucagon Antibody (H00002641-M01) (0)

There are no reviews for Glucagon Antibody (H00002641-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glucagon Antibody (H00002641-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glucagon Products

Bioinformatics Tool for Glucagon Antibody (H00002641-M01)

Discover related pathways, diseases and genes to Glucagon Antibody (H00002641-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucagon Antibody (H00002641-M01)

Discover more about diseases related to Glucagon Antibody (H00002641-M01).
 

Pathways for Glucagon Antibody (H00002641-M01)

View related products by pathway.

PTMs for Glucagon Antibody (H00002641-M01)

Learn more about PTMs related to Glucagon Antibody (H00002641-M01).
 

Research Areas for Glucagon Antibody (H00002641-M01)

Find related products by research area.

Blogs on Glucagon

There are no specific blogs for Glucagon, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucagon Antibody (2D3-2B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol GCG
Entrez
OMIM
Uniprot