Home » GLP-2R » GLP-2R Proteins » GLP-2R Recombinant Protein Antigen

GLP-2R Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GLP-2R Protein (NBP2-33557PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

GLP-2R Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLP2R.

Source: E.coli

Amino Acid Sequence: LPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPC
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GLP2R
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-33557.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GLP-2R Recombinant Protein Antigen

  • GLP-2 receptor
  • GLP2R
  • GLP-2R
  • GLP-2-R
  • glucagon-like peptide 2 receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GLP1 Antibody
(5B10) - BSA Free
NBP1-05189
Immunocytochemistry/Immunofluorescence: Glucagon Antibody (5B10) - BSA Free [NBP1-05189] - Staining in human liver tissue. Signal is strong in the cytoplasmic site of hepatocytes. Dilution: 1:4000.
Immunohistochemistry-Paraffin: Glucagon Antibody (5B10) - BSA Free [NBP1-05189] - Staining of Human liver tissue. Hepatocytes were stained strongly. Dilution: 1:3200
Immunocytochemistry/Immunofluorescence: Glucagon Antibody (5B10) - BSA Free [NBP1-05189] - Staining in human pancreas tissue. Signal is strong in alpha cells. Dilution: 1:4000.
Species: Hu, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
IGF-I/IGF-1
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I/IGF-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I/IGF-1 (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I/IGF-1.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(5 Reviews)
(137 Publications)
Species: Hu
KGF/FGF-7
[Unconjugated]
251-KG
Recombinant Human KGF/FGF-7 (Catalog # 251-KG) stimulates cell proliferation of 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 6‑60 ng/mL.
(48 Publications)
Species: Hu
DPPIV/CD26
Antibody [Unconjugate
AF1180
Western blot shows lysate of LoVo human colorectal adenocarcinoma cell line. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Human DPPIV/CD26 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1180) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for DPPIV/CD26 at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysate of human peripheral blood mononuclear cells (PBMC). PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Human DPPIV/CD26 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1180) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for DPPIV/CD26 at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of LoVo human colorectal adenocarcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for DPPIV/CD26 at approximately 168 kDa (as indicated) using 2 µg/mL of Goat Anti-Human DPPIV/CD26 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1180) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(4 Reviews)
(23 Publications)
Species: Hu
Applications: WB, Simple Western, IHC, ICC
GLP/EHMT1 Antibody
(B0422) [Unconjugated ...
PP-B0422-00
GLP/EHMT1 Antibody (B0422) [Unconjugated]
(7 Reviews)
(9 Publications)
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
GLP-1R Antibody
NBP1-97308
Western Blot: GLP-1R Antibody [NBP1-97308] - Total protein from Human and Mouse brain and SHSY-5Y cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-GLP1R in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Western Blot: GLP-1R Antibody [NBP1-97308] - Analysis of GLP1R in human pancreas cell lysate.
Simple Western: GLP-1R Antibody [NBP1-97308] - Simple Western lane view shows a specific band for GLP-1R in 0.5 mg/ml of Human Pancreas (left) and Mouse Pancreas (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody
(17 Publications)
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P, KD
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
RCBTB1 Antibody
NBP2-20116
Western Blot: RCBTB1 Antibody [NBP2-20116] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 7. 5% SDS PAGE gel, diluted at 1:2000.
Immunocytochemistry/Immunofluorescence: RCBTB1 Antibody [NBP2-20116] - Analysis of paraformaldehyde-fixed MCF-7, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: RCBTB1 Antibody [NBP2-20116] - Immunohistochemical analysis of paraffin-embedded J5 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
GOLGA6 Antibody
NB100-2436
Immunohistochemistry-Paraffin: GOLGA6 Antibody [NB100-2436] - Paraffin embedded Human Cerebral Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Analysis of cell lysates using mouse c-Fos mAb, dilution 1:1,000 (Green), and rabbit GAPDH pAb, dilution 1:20,000 (Red) used as a loading control. [1] protein standard (red), [2] HeLa cells in serum free media. [3] HeLa cells stimulated with 20% fetal bovine serum for 2hrs after 36hrs in serum free media. [4] rat cortical neurons. [5] rat cortical neurons treated with membrane depolarization buffer for 5hrs. Multiple bands at 50-65kDa in stimulated or treated cell lysates correspond to different forms of the c-Fos proten. The single band at 37 kDa represents GAPDH protein.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
VIP Antibody (2) -
BSA Free
NBP1-05163
Immunocytochemistry/Immunofluorescence: VIP Antibody (2) [NBP1-05163] - Staining in human pancreas tissue. Signal is strong in nerves of exocrine part of pancreas. Dilution: 1:100.
Immunohistochemistry-Paraffin: VIP Antibody (2) - BSA Free [NBP1-05163] - Formalin fixed paraffin-embedded human pancreas tissue. Dilution: 1:100
Immunohistochemistry-Paraffin: VIP Antibody (2) [NBP1-05163] - Staining of human appendix tissue. Dilution: 1:100
(1 Publication)
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
EGFR Antibody
[Unconjugated]
AF1280
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for EGFR at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
EGFR was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EGFR at approximately 180-191 kDa (as indicated) using 2.5 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Review)
(7 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(19 Reviews)
(452 Publications)
Species: Hu
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Staining of paraffin embedded Human Pituitary Gland. Antibody at 2 ug/mL. Steamed antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(10 Publications)
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
GPR151 Antibody
NLS418
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Anti-GPR151 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Analysis of anti-GPR151 antibody with brain, thalamus at 2 ug/ ml.
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Analysis of anti-GPR151 antibody with human brain, glioblastoma.
Species: Hu
Applications: IHC, IHC-P
MRGX1 Antibody
NLS2756
Immunohistochemistry-Paraffin: MRGX1 Antibody [NLS2756] - Anti-MRGX1 / MRGPRX1 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: MRGX1 Antibody [NLS2756] - Analysis of anti-MRGPRX1 / MRGX1 antibody with human ganglion cells and Schwann cells.
Immunohistochemistry-Paraffin: MRGX1 Antibody [NLS2756] - Anti-MRGX1 / MRGPRX1 antibody IHC of human Ovary, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
Lgr6 Antibody
NLS442
Immunohistochemistry-Paraffin: Lgr6 Antibody [NLS442] - Brain, Amygdala
Immunohistochemistry-Paraffin: Lgr6 Antibody [NLS442] - Analysis of anti-LGR6 antibody with human brain, neuron at 2.5 ug/ml.
Immunohistochemistry-Paraffin: Lgr6 Antibody [NLS442] - Skin, melanoma
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
GLP-2R Recombinant
Protein Antigen
NBP2-33557PEP
GLP-2R Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for GLP-2R Protein (NBP2-33557PEP) (0)

There are no publications for GLP-2R Protein (NBP2-33557PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLP-2R Protein (NBP2-33557PEP) (0)

There are no reviews for GLP-2R Protein (NBP2-33557PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GLP-2R Protein (NBP2-33557PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional GLP-2R Products

Bioinformatics Tool for GLP-2R Protein (NBP2-33557PEP)

Discover related pathways, diseases and genes to GLP-2R Protein (NBP2-33557PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLP-2R Protein (NBP2-33557PEP)

Discover more about diseases related to GLP-2R Protein (NBP2-33557PEP).
 

Pathways for GLP-2R Protein (NBP2-33557PEP)

View related products by pathway.

PTMs for GLP-2R Protein (NBP2-33557PEP)

Learn more about PTMs related to GLP-2R Protein (NBP2-33557PEP).
 

Research Areas for GLP-2R Protein (NBP2-33557PEP)

Find related products by research area.

Blogs on GLP-2R

There are no specific blogs for GLP-2R, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
EGF [Unconjugated]
236-EG-200

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GLP-2R Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GLP2R