GLI-3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GLI-3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLI3.
  
  

  Source: E. coli

  Amino Acid Sequence: GQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GLI3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89275.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GLI-3 Recombinant Protein Antigen

• ACLS
• ACLSPAPAPHS
• ADD
• Bph
• GCPS
• GLI family zinc finger 3
• GLI3 form of 190 kDa
• GLI3 full length protein
• GLI3
• GLI-3
• GLI3-190
• GLI3FL
• GLI-Kruppel family member GLI3
• glioma-associated oncogene family zinc finger 3
• Greig cephalopolysyndactyly syndrome
• oncogene GLI3
• PAP-A
• PAPA1
• PAPB
• PAPBDNA-binding protein
• Pdn
• PHS
• PPDIV
• Xt
• zinc finger protein GLI3

Background

Gli-3 (also known as Zinc Finger Protein Gli-3 or GLI-Kruppel family member GLI-3) belongs to the GLI C2H2-type zinc-finger protein family and contains 5 C2H2-type zinc fingers. Gli-3 is very important for normal limb and brain development and is implicated in the transduction of Shh signal. Gli-3 is a nuclear protein expressed in a wide variety of normal adult tissues, including lung, colon, spleen, placenta, testis, and myometrium. Defects in Gli-3 are the cause of Greig cephalo-polysyndactyly syndrome (GCPS); an autosomal dominant disorder-affecting limb and craniofacial development. Two isoforms of human Gli-3 have been reported. One is the fulllength protein at ~170-190kDa and the other is a truncated isoform at ~80kDa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLI3