GLI-3 Recombinant Protein Antigen

Images

 
There are currently no images for GLI-3 Protein (NBP1-89275PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GLI-3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLI3.

Source: E. coli

Amino Acid Sequence: GQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GLI3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89275.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GLI-3 Recombinant Protein Antigen

  • ACLS
  • ACLSPAPAPHS
  • ADD
  • Bph
  • GCPS
  • GLI family zinc finger 3
  • GLI3 form of 190 kDa
  • GLI3 full length protein
  • GLI3
  • GLI-3
  • GLI3-190
  • GLI3FL
  • GLI-Kruppel family member GLI3
  • glioma-associated oncogene family zinc finger 3
  • Greig cephalopolysyndactyly syndrome
  • oncogene GLI3
  • PAP-A
  • PAPA1
  • PAPB
  • PAPBDNA-binding protein
  • Pdn
  • PHS
  • PPDIV
  • Xt
  • zinc finger protein GLI3

Background

Gli-3 (also known as Zinc Finger Protein Gli-3 or GLI-Kruppel family member GLI-3) belongs to the GLI C2H2-type zinc-finger protein family and contains 5 C2H2-type zinc fingers. Gli-3 is very important for normal limb and brain development and is implicated in the transduction of Shh signal. Gli-3 is a nuclear protein expressed in a wide variety of normal adult tissues, including lung, colon, spleen, placenta, testis, and myometrium. Defects in Gli-3 are the cause of Greig cephalo-polysyndactyly syndrome (GCPS); an autosomal dominant disorder-affecting limb and craniofacial development. Two isoforms of human Gli-3 have been reported. One is the fulllength protein at ~170-190kDa and the other is a truncated isoform at ~80kDa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC,  IHC-P, KD, WB
AF3635
Species: Mu
Applications: IHC, WB
NBP1-47914
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB41051
Species: Hu, Mu
Applications: WB
AF1705
Species: Mu
Applications: IHC, WB
NLS2666
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP3-04509
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: IHC,  IHC-P, WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87343
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-20223
Species: Hu
Applications: ICC/IF, IP, WB
423-F8
Species: Hu, Mu
Applications: BA

Publications for GLI-3 Protein (NBP1-89275PEP) (0)

There are no publications for GLI-3 Protein (NBP1-89275PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLI-3 Protein (NBP1-89275PEP) (0)

There are no reviews for GLI-3 Protein (NBP1-89275PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GLI-3 Protein (NBP1-89275PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GLI-3 Products

Array NBP1-89275PEP

Research Areas for GLI-3 Protein (NBP1-89275PEP)

Find related products by research area.

Blogs on GLI-3

There are no specific blogs for GLI-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GLI-3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GLI3