GIP Recombinant Protein Antigen

Images

 
There are currently no images for GIP Recombinant Protein Antigen (NBP3-17034PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GIP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GIP

Source: E. coli

Amino Acid Sequence: DWKHNITQREARALELAGQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GIP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17034.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GIP Recombinant Protein Antigen

  • gastric inhibitory polypeptide
  • GIP
  • Glucose-dependent Insulinotropic Polypeptide
  • Incretin

Background

The GIP gene encodes an incretin hormone and belongs to the glucagon superfamily. The encoded protein is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nu

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP3-18225
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46349
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-41177
Species: Mu
Applications: IHC, IHC-P, WB
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-97308
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
MAB8210
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC
NBP2-93868
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP3-03282
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for GIP Recombinant Protein Antigen (NBP3-17034PEP) (0)

There are no publications for GIP Recombinant Protein Antigen (NBP3-17034PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GIP Recombinant Protein Antigen (NBP3-17034PEP) (0)

There are no reviews for GIP Recombinant Protein Antigen (NBP3-17034PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GIP Recombinant Protein Antigen (NBP3-17034PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GIP Products

Research Areas for GIP Recombinant Protein Antigen (NBP3-17034PEP)

Find related products by research area.

Blogs on GIP.

Inhibiting incretin GIP hormone activity in mouse and monkey models to combat obesity
By Jamshed Arslan, Pharm. D., PhD. We live in a world where 39% of adults are overweight. Our meals trigger the secretion of various gut-derived metabolic hormones called incretins. Fats and carbohydrates in our die...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GIP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GIP