GGT1 Antibody

Western Blot: GGT1 Antibody [NBP2-56998] - Analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: GGT1 Antibody [NBP2-56998] - Staining of human cell line A549 shows localization to vesicles.

Product Discontinued

GGT1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MFNSSEQSQKGGLSVAVPGEIRGYELAHQRHG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GGT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GGT1 Antibody

• CD224 antigen
• CD224
• D22S672
• D22S73
• D22S732
• EC 2.3.2.2
• gamma-glutamyl transpeptidase
• gamma-Glutamyltransferase 1
• gamma-glutamyltransferase 1MGC96904
• gamma-glutamyltranspeptidase 1
• GGT 1
• GGT
• GGT-1
• GGTD
• GGTMGC96963
• glutamyl transpeptidase
• GTG
• MGC96892

Background

The enzyme encoded by this gene catalyzes the transfer of the glutamyl moiety of glutathione to a variety of amino acids and dipeptide acceptors. The enzyme is composed of a heavy chain and a light chain, which are derived from a single precursor protein, and is present in tissues involved in absorption and secretion. This enzyme is a member of the gamma-glutamyltransferase protein family, of which many members have not yet been fully characterized and some of which may represent pseudogenes. This gene is classified as type I gamma-glutamyltransferase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GGT1