GGPS1 Antibody (1C3)

Images

 
Western Blot: GGPS1 Antibody (1C3) [H00009453-M08] - GGPS1 monoclonal antibody (M08), clone 1C3 Western Blot analysis of GGPS1 expression in HeLa ( Cat # L013V1 ).
ELISA: GGPS1 Antibody (1C3) [H00009453-M08] - Detection limit for recombinant GST tagged GGPS1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GGPS1 Antibody (1C3) Summary

Immunogen
GGPS1 (NP_004828, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE
Specificity
geranylgeranyl diphosphate synthase 1
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GGPS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GGPS1 Antibody (1C3)

  • 6E)-farnesyl diphosphate synthase
  • dimethylallyltranstransferase
  • EC 2.5.1.1
  • EC 2.5.1.10
  • EC 2.5.1.29
  • Farnesyl diphosphate synthase
  • Farnesyltranstransferase
  • geranylgeranyl diphosphate synthase 1
  • Geranylgeranyl diphosphate synthase
  • geranylgeranyl pyrophosphate synthase
  • geranyltranstransferase
  • GGPP synthase
  • GGPPS
  • GGPPS1farnesyltranstransferase
  • GGPPSase

Background

This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GGPS1 Antibody (H00009453-M08) (0)

There are no publications for GGPS1 Antibody (H00009453-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GGPS1 Antibody (H00009453-M08) (0)

There are no reviews for GGPS1 Antibody (H00009453-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GGPS1 Antibody (H00009453-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GGPS1 Products

Research Areas for GGPS1 Antibody (H00009453-M08)

Find related products by research area.

Blogs on GGPS1

There are no specific blogs for GGPS1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GGPS1 Antibody (1C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol GGPS1
Entrez
OMIM