GGA1 Antibody


Western Blot: GGA1 Antibody [NBP2-14048] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HEK 293
Immunohistochemistry-Paraffin: GGA1 Antibody [NBP2-14048] - Staining of human tonsil shows strong cytoplasmic positivity in germinal and non-germinal center cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GGA1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DNLTQVINLYKQLVRGEEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTY PAMPTRP
Specificity of human GGA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GGA1 Protein (NBP2-14048PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GGA1 Antibody

  • ADP-ribosylation factor binding protein 1
  • ADP-ribosylation factor-binding protein GGA1
  • gamma adaptin ear containing, ARF binding protein 1
  • gamma-adaptin related protein 1
  • Gamma-adaptin-related protein 1
  • golgi-associated, gamma adaptin ear containing, ARF binding protein 1
  • Golgi-localized, gamma ear-containing, ARF-binding protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC, Block

Publications for GGA1 Antibody (NBP2-14048) (0)

There are no publications for GGA1 Antibody (NBP2-14048).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GGA1 Antibody (NBP2-14048) (0)

There are no reviews for GGA1 Antibody (NBP2-14048). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GGA1 Antibody (NBP2-14048) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GGA1 Products

Bioinformatics Tool for GGA1 Antibody (NBP2-14048)

Discover related pathways, diseases and genes to GGA1 Antibody (NBP2-14048). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GGA1 Antibody (NBP2-14048)

Discover more about diseases related to GGA1 Antibody (NBP2-14048).

Pathways for GGA1 Antibody (NBP2-14048)

View related products by pathway.

PTMs for GGA1 Antibody (NBP2-14048)

Learn more about PTMs related to GGA1 Antibody (NBP2-14048).

Research Areas for GGA1 Antibody (NBP2-14048)

Find related products by research area.

Blogs on GGA1

There are no specific blogs for GGA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GGA1 Antibody and receive a gift card or discount.


Gene Symbol GGA1