GGA1 Antibody

Images

 
Western Blot: GGA1 Antibody [NBP2-14047] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: GGA1 Antibody [NBP2-14047] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: GGA1 Antibody [NBP2-14047] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GGA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTP RLTLRDLQNKSSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GGA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GGA1 Protein (NBP2-14047PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GGA1 Antibody

  • ADP-ribosylation factor binding protein 1
  • ADP-ribosylation factor-binding protein GGA1
  • gamma adaptin ear containing, ARF binding protein 1
  • gamma-adaptin related protein 1
  • Gamma-adaptin-related protein 1
  • golgi-associated, gamma adaptin ear containing, ARF binding protein 1
  • Golgi-localized, gamma ear-containing, ARF-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58645
Species: Hu
Applications: WB, ICC/IF
NBP2-55191
Species: Hu
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5699
Species: Hu, Mu
Applications: WB, IHC
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block

Publications for GGA1 Antibody (NBP2-14047) (0)

There are no publications for GGA1 Antibody (NBP2-14047).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GGA1 Antibody (NBP2-14047) (0)

There are no reviews for GGA1 Antibody (NBP2-14047). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GGA1 Antibody (NBP2-14047) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GGA1 Products

Bioinformatics Tool for GGA1 Antibody (NBP2-14047)

Discover related pathways, diseases and genes to GGA1 Antibody (NBP2-14047). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GGA1 Antibody (NBP2-14047)

Discover more about diseases related to GGA1 Antibody (NBP2-14047).
 

Pathways for GGA1 Antibody (NBP2-14047)

View related products by pathway.

PTMs for GGA1 Antibody (NBP2-14047)

Learn more about PTMs related to GGA1 Antibody (NBP2-14047).
 

Research Areas for GGA1 Antibody (NBP2-14047)

Find related products by research area.

Blogs on GGA1

There are no specific blogs for GGA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GGA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GGA1