GFM2 Antibody

Images

 
Immunohistochemistry: GFM2 Antibody [NBP2-14043] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GFM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDYLSPVLADLAQ RRGNIQEIQTRQDNKVVIGFVPLAEIMGYST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GFM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GFM2 Protein (NBP2-14043PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GFM2 Antibody

  • EFG2MSTP027
  • Elongation factor G 2, mitochondrial
  • Elongation factor G2
  • G elongation factor, mitochondrial 2
  • mitochondrial
  • MRRF2
  • MST027

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83997
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45434
Species: Hu
Applications: WB, IHC
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
AF4764
Species: Hu
Applications: WB, IHC, ICC
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NLS1513
Species: Hu
Applications: IHC-P
NBP1-91444
Species: Hu
Applications: WB

Publications for GFM2 Antibody (NBP2-14043) (0)

There are no publications for GFM2 Antibody (NBP2-14043).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFM2 Antibody (NBP2-14043) (0)

There are no reviews for GFM2 Antibody (NBP2-14043). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GFM2 Antibody (NBP2-14043) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GFM2 Products

Bioinformatics Tool for GFM2 Antibody (NBP2-14043)

Discover related pathways, diseases and genes to GFM2 Antibody (NBP2-14043). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GFM2 Antibody (NBP2-14043)

Discover more about diseases related to GFM2 Antibody (NBP2-14043).
 

Pathways for GFM2 Antibody (NBP2-14043)

View related products by pathway.

Blogs on GFM2

There are no specific blogs for GFM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GFM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GFM2