Recombinant Human Gemin 5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Gemin 5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 401-510 of Human GEMIN5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DGMIRVWNTLSIKNNYDVKNFWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTYHKKTVYTLAWGPPVPPMSLGGEGDRPSLALYSCGGEGIVLQH

Protein/Peptide Type
Partial Recombinant Protein
Gene
GEMIN5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Gemin 5 Protein

  • DKFZp586M1824
  • EC 2.7.7.8
  • EC 5.4.2.1
  • gem (nuclear organelle) associated protein 5
  • gem-associated protein 5
  • gemin 5
  • Gemin5
  • MGC142174

Background

GEMIN5 is part of a large macromolecular complex localized to both the cytoplasm and the nucleus that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), and GEMIN4 (MIM 606969).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-52453
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NBP1-82075
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24740
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
H00079760-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-43792
Species: Hu
Applications: WB
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-55266
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt

Publications for Gemin 5 Partial Recombinant Protein (H00025929-Q01) (0)

There are no publications for Gemin 5 Partial Recombinant Protein (H00025929-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gemin 5 Partial Recombinant Protein (H00025929-Q01) (0)

There are no reviews for Gemin 5 Partial Recombinant Protein (H00025929-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gemin 5 Partial Recombinant Protein (H00025929-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gemin 5 Products

Bioinformatics Tool for Gemin 5 Partial Recombinant Protein (H00025929-Q01)

Discover related pathways, diseases and genes to Gemin 5 Partial Recombinant Protein (H00025929-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gemin 5 Partial Recombinant Protein (H00025929-Q01)

Discover more about diseases related to Gemin 5 Partial Recombinant Protein (H00025929-Q01).
 

Pathways for Gemin 5 Partial Recombinant Protein (H00025929-Q01)

View related products by pathway.

PTMs for Gemin 5 Partial Recombinant Protein (H00025929-Q01)

Learn more about PTMs related to Gemin 5 Partial Recombinant Protein (H00025929-Q01).

Blogs on Gemin 5

There are no specific blogs for Gemin 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Gemin 5 Antibody
NB100-61049

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Gemin 5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GEMIN5