Recombinant Human GDAP1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GDAP1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-290 of Human GDAP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
GDAP1
Purity
>10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
57.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GDAP1 GST (N-Term) Protein

  • Charcot-Marie-Tooth neuropathy 4A
  • CMT2K
  • CMT4
  • CMT4A
  • CMTRIA
  • ganglioside differentiation associated protein 1
  • ganglioside-induced differentiation-associated protein 1
  • truncated ganglioside differentiation associated protein 1

Background

This gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-67068
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13283
Species: Hu
Applications: WB, IHC, IHC-P
H00008898-M03
Species: Hu, Rt
Applications: WB, ELISA, S-ELISA
NB100-57493
Species: Hu, Mu
Applications: WB, IP
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, RNAi, S-ELISA
NBP2-55414
Species: Hu
Applications: WB, ICC/IF
NBP2-53381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr
NBP2-25151
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF
NBL1-15012
Species: Hu
H00009588-M01
Species: Hu, Bv
Applications: WB, DB, ELISA, S-ELISA
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-132
Species: Hu, Mu, Rt, Av, Bv, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89598
Species: Hu, Mu, Ca
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38360
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47477
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GDAP1 Recombinant Protein (H00054332-P01) (0)

There are no publications for GDAP1 Recombinant Protein (H00054332-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDAP1 Recombinant Protein (H00054332-P01) (0)

There are no reviews for GDAP1 Recombinant Protein (H00054332-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDAP1 Recombinant Protein (H00054332-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional GDAP1 Products

Array H00054332-P01

Bioinformatics Tool for GDAP1 Recombinant Protein (H00054332-P01)

Discover related pathways, diseases and genes to GDAP1 Recombinant Protein (H00054332-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDAP1 Recombinant Protein (H00054332-P01)

Discover more about diseases related to GDAP1 Recombinant Protein (H00054332-P01).
 

Pathways for GDAP1 Recombinant Protein (H00054332-P01)

View related products by pathway.

PTMs for GDAP1 Recombinant Protein (H00054332-P01)

Learn more about PTMs related to GDAP1 Recombinant Protein (H00054332-P01).

Blogs on GDAP1

There are no specific blogs for GDAP1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GDAP1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GDAP1