Recombinant Human GCNT2 GST (N-Term) Protein

SDS-Page: Recombinant Human GCNT2 Protein [H00002651-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human GCNT2 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-402 of Human GCNT2 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYITSPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Full Length Recombinant Protein
• Gene: GCNT2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 72.9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GCNT2 GST (N-Term) Protein

• bA360O19.2
• bA421M1.1
• beta-1,6-N-acetylglucosaminyltransferase 2
• cataract, congenital
• CCAT
• CTRCT13
• EC 2.4.1.150
• GCNT2
• GCNT2C
• GCNT5
• glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)
• glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (Ii blood group)
• glucosaminyl (N-acetyl) transferase 2, I-branching enzyme
• I beta-1,6-N-acetylglucosaminyltransferase
• I-branching beta-1,6-acetylglucosaminyltransferase
• I-branching enzyme
• IGNTglucosaminyl (N-acetyl) transferase 5
• Ii blood group
• II
• MGC163396
• N-acetylglucosaminyltransferase
• N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase
• N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
• NACGT1
• NAGCT1
• ULG3

Background

This gene encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GCNT2