GCC185 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GCC185 Antibody [NBP1-89788] - staining of human cell line U-2 OS shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GCC185 Antibody [NBP1-89788] - Staining of human colon shows distinct cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCC185 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QNISEANSQHYQKNINSLQEELLQLKAIHQEEVKELMCQIEASAKEHEAEINKLNELKENLVKQCEASEKNIQKKYECELENLRKATSNANQDNQICSIL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GCC185 Protein (NBP1-89788PEP)
Publications
Read Publication using
NBP1-89788 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25359980).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GCC185 Antibody

  • 185 kDa Golgi coiled-coil protein
  • CLL-associated antigen KW-11
  • CTCL tumor antigen se1-1
  • GCC protein, 185-kD
  • GCC185GRIP and coiled-coil domain-containing 2
  • Golgi coiled-coil protein GCC185
  • GRIP and coiled-coil domain containing 2
  • GRIP and coiled-coil domain-containing protein 2
  • KIAA0336REN53
  • Ran-binding protein 2-like 4
  • RANBP2L4
  • Renal carcinoma antigen NY-REN-53

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83609
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-49680
Species: Hu
Applications: WB, IHC
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38528
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-621
Species: Hu, Rt, Bv, Ca, Ha, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IM, IP
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21395
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-92467
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93719
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-75457
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-81663
Species: Hu
Applications: IHC, IHC-P
NBP2-30981
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GCC185 Antibody (NBP1-89788)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GCC185 Antibody (NBP1-89788) (0)

There are no reviews for GCC185 Antibody (NBP1-89788). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GCC185 Antibody (NBP1-89788) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCC185 Products

Bioinformatics Tool for GCC185 Antibody (NBP1-89788)

Discover related pathways, diseases and genes to GCC185 Antibody (NBP1-89788). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCC185 Antibody (NBP1-89788)

Discover more about diseases related to GCC185 Antibody (NBP1-89788).
 

Pathways for GCC185 Antibody (NBP1-89788)

View related products by pathway.

PTMs for GCC185 Antibody (NBP1-89788)

Learn more about PTMs related to GCC185 Antibody (NBP1-89788).

Blogs on GCC185

There are no specific blogs for GCC185, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCC185 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCC2