GCAP3 Antibody - Azide and BSA Free Summary
Immunogen |
GUCA1C (NP_005450.2, 1 a.a. - 209 a.a.) full-length human protein. MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GUCA1C |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
Application Notes |
This antibody is useful for Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GCAP3 Antibody - Azide and BSA Free
Background
GCAP3, also known as GUCA1C or Guanylyl cyclase-activating protein 3, has a 209 amino acid isoform that is 24 kDa and a short 196 amino acid isoform that is approx. 22 kDa; commonly found in retina; in conditions of low free calcium ions concentration stimulates guanylyl cyclase 1 (GC1) and GC2 and when the concentration is elevated inhibits guanylyl cyclases, which is very important for the recuperation of the dark state of rod photoreceptors following light exposure. Disease research has linked this protein with cone dystrophy, neuronitis, and retinitis. This protein has shown interactions with GUCA1A, GUCA1B, GUCY2D, GUCY2F, and CNGA3 proteins in the pathways such as the visual cycle in retinal rods, olfactory transduction, and phototransduction pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, ELISA(Cap), S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, ICC/IF
Publications for GCAP3 Antibody (H00009626-D01P) (0)
There are no publications for GCAP3 Antibody (H00009626-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GCAP3 Antibody (H00009626-D01P) (0)
There are no reviews for GCAP3 Antibody (H00009626-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GCAP3 Antibody (H00009626-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GCAP3 Products
Blogs on GCAP3