GBP3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit GBP3 Antibody - BSA Free (NBP2-84959) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of GBP3. Peptide sequence: MDQLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GBP3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for GBP3 Antibody - BSA Free
Background
The GBP3 gene codes for a member of the germinal center kinase family that demonstrates antiviral activity against influenza. One isoform is 595 amino acids long at 68 kDa and the other exists at 544 amino acids in length at nearly 62 kDA. The GBP3 gene has been studied in hypoglycemic comas, hepatitis B, and influenza and interacts in pathways of interferon gamma signaling, cytokine signaling in the immune system, and expression of IFNG-stimulated genes. It interacts with genes MAP4K4, NFATC2, and FAM107B.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Mu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Publications for GBP3 Antibody (NBP2-84959) (0)
There are no publications for GBP3 Antibody (NBP2-84959).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GBP3 Antibody (NBP2-84959) (0)
There are no reviews for GBP3 Antibody (NBP2-84959).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GBP3 Antibody (NBP2-84959) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GBP3 Products
Blogs on GBP3