GBP3 Antibody - BSA Free

Western Blot: GBP3 Antibody [NBP2-84958] - Host: Rabbit. Target Name: GBP3. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GBP3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GBP3 Antibody - BSA Free (NBP2-84958) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GBP3. Peptide sequence: ILTEKEKEIEVECVKAESAQASAKMVEEMQIKYQQMMEEKEKSYQEHVKQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GBP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GBP3 Antibody - BSA Free

• DKFZp686E0974
• DKFZp686L15228
• FLJ10961
• GBP-3
• GTP-binding protein 3
• Guanine nucleotide-binding protein 3
• guanylate binding protein 3
• guanylate-binding protein 3

Background

The GBP3 gene codes for a member of the germinal center kinase family that demonstrates antiviral activity against influenza. One isoform is 595 amino acids long at 68 kDa and the other exists at 544 amino acids in length at nearly 62 kDA. The GBP3 gene has been studied in hypoglycemic comas, hepatitis B, and influenza and interacts in pathways of interferon gamma signaling, cytokine signaling in the immune system, and expression of IFNG-stimulated genes. It interacts with genes MAP4K4, NFATC2, and FAM107B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GBP3