Gastrin-releasing Peptide R/GRPR Antibody

Immunocytochemistry/Immunofluorescence: Gastrin-releasing Peptide R/GRPR Antibody [NBP2-57398] - Staining of human cell line PC-3 shows localization to plasma membrane. Antibody staining is shown in green.

Product Discontinued

Gastrin-releasing Peptide R/GRPR Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRPR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Gastrin-releasing Peptide R/GRPR Antibody

• Gastrin-releasing Peptide R
• gastrin-releasing peptide receptor
• Gastrinreleasing PeptideR
• Gastrin-releasing PeptideR
• GRP-preferring bombesin receptor
• GRPR
• GRP-R

Background

GRPR mediates signals of cellular proliferation and it has been shown to be aberrantly expressed in several cancers such as colon, lung, ovary, pancreas and prostate. It also expressed at very high levels in normal pancreas and at lower levels in brain, breast, colon, lung, lymph node, ovary, placenta, prostate, stomach and uterus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRPR