Gastrin-releasing Peptide R/GRPR Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GRPR |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Gastrin-releasing Peptide R/GRPR Antibody
Background
GRPR mediates signals of cellular proliferation and it has been shown to be aberrantly expressed in several cancers such as colon, lung, ovary, pancreas and prostate. It also expressed at very high levels in normal pancreas and at lower levels in brain, breast, colon, lung, lymph node, ovary, placenta, prostate, stomach and uterus.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB
Species: Bt, Bv, Eq, Hu, Mu, Po, Rb
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF
Publications for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398) (0)
There are no publications for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398) (0)
There are no reviews for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Gastrin-releasing Peptide R/GRPR Products
Research Areas for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398)
Find related products by research area.
|
Blogs on Gastrin-releasing Peptide R/GRPR