Gastrin-releasing Peptide R/GRPR Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Gastrin-releasing Peptide R/GRPR Antibody [NBP2-57398] - Staining of human cell line PC-3 shows localization to plasma membrane. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Gastrin-releasing Peptide R/GRPR Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHP
Specificity
Specificity of human Gastrin-releasing Peptide R/GRPR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRPR
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Gastrin-releasing Peptide R/GRPR Recombinant Protein Antigen (NBP2-57398PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Gastrin-releasing Peptide R/GRPR Antibody

  • Gastrin-releasing Peptide R
  • gastrin-releasing peptide receptor
  • Gastrinreleasing PeptideR
  • Gastrin-releasing PeptideR
  • GRP-preferring bombesin receptor
  • GRPR
  • GRP-R

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-72115
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP3-04445
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NBP1-91923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS825
Species: Hu, Mu, Po, Bt, Bv, Eq, Rb
Applications: Flow, IHC, IHC-P
NBP2-93843
Species: Hu, Mu, Rt
Applications: WB
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
AF2550
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP2-57398
Species: Hu
Applications: ICC/IF

Publications for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398) (0)

There are no publications for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398) (0)

There are no reviews for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Gastrin-releasing Peptide R/GRPR Products

Bioinformatics Tool for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398)

Discover related pathways, diseases and genes to Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398)

Discover more about diseases related to Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398).
 

Pathways for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398)

View related products by pathway.

PTMs for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398)

Learn more about PTMs related to Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398).
 

Research Areas for Gastrin-releasing Peptide R/GRPR Antibody (NBP2-57398)

Find related products by research area.

Blogs on Gastrin-releasing Peptide R/GRPR

There are no specific blogs for Gastrin-releasing Peptide R/GRPR, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gastrin-releasing Peptide R/GRPR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRPR