Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (3A11)

Images

 
Western Blot: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (3A11) [H00002922-M03] - Analysis of GRP expression in transfected 293T cell line by GRP monoclonal antibody (M03), clone 3A11. Lane 1: GRP ...read more
Sandwich ELISA: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (3A11) [H00002922-M03] - Detection limit for recombinant GST tagged GRP is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (3A11) Summary

Immunogen
GRP (AAH04488, 1 a.a. - 148 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GRP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (3A11)

  • BN
  • Bombesin
  • Gastrinreleasing Peptide
  • Gastrin-releasing Peptide
  • GRP
  • GRP10
  • GRP-10
  • neuromedin C
  • pre-progastrin releasing peptide
  • preproGRP
  • proGRP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-30061
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-46576
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF2330
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-48988
Species: Hu
Applications: IHC

Publications for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03) (0)

There are no publications for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03) (0)

There are no reviews for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gastrin-releasing Peptide/Bombesin/Neuromedin C Products

Bioinformatics Tool for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03)

Discover related pathways, diseases and genes to Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03)

Discover more about diseases related to Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03).
 

Pathways for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03)

View related products by pathway.

PTMs for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03)

Learn more about PTMs related to Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03).
 

Research Areas for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (H00002922-M03)

Find related products by research area.

Blogs on Gastrin-releasing Peptide/Bombesin/Neuromedin C

There are no specific blogs for Gastrin-releasing Peptide/Bombesin/Neuromedin C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (3A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol GRP
Entrez
Uniprot