| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSDMD |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | See Simple Western Antibody Database for Simple Western validation: Tested in Human cells 1 mg/mL, separated by Size, antibody dilution of 1:25, apparent MW was 52 kDa |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Eric Wang |
WB | Human | 06/21/2021 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Gasdermin D Antibody (NBP2-33422)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.