GAS41 Antibody

Images

 
Western Blot: GAS41 Antibody [H00008089-B02P] - Analysis of YEATS4 expression in transfected 293T cell line by YEATS4 polyclonal antibody. Lane 1: YEATS4 transfected lysate(24.97 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [H00008089-B02P] - Analysis of purified antibody to YEATS4 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GAS41 Antibody Summary

Immunogen
YEATS4 (NP_006521.1, 1 a.a. - 227 a.a.) full-length human protein. MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI
Specificity
YEATS4 - YEATS domain containing 4,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
YEATS4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GAS41 Antibody

  • B230215M10Rik
  • Gas41,4930573H17Rik
  • GAS41glioma-amplified sequence-41
  • Glioma-amplified sequence 41
  • nuBI1
  • NUBI-1
  • NuMA binding protein 1
  • NuMA-binding protein 1
  • YAF9
  • YEATS domain containing 4
  • YEATS domain-containing protein 4

Background

The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-84063
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBL1-11569
Species: Hu
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-90222
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu

Publications for GAS41 Antibody (H00008089-B02P) (0)

There are no publications for GAS41 Antibody (H00008089-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAS41 Antibody (H00008089-B02P) (0)

There are no reviews for GAS41 Antibody (H00008089-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GAS41 Antibody (H00008089-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAS41 Products

Bioinformatics Tool for GAS41 Antibody (H00008089-B02P)

Discover related pathways, diseases and genes to GAS41 Antibody (H00008089-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAS41 Antibody (H00008089-B02P)

Discover more about diseases related to GAS41 Antibody (H00008089-B02P).
 

Pathways for GAS41 Antibody (H00008089-B02P)

View related products by pathway.

PTMs for GAS41 Antibody (H00008089-B02P)

Learn more about PTMs related to GAS41 Antibody (H00008089-B02P).
 

Research Areas for GAS41 Antibody (H00008089-B02P)

Find related products by research area.

Blogs on GAS41

There are no specific blogs for GAS41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAS41 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YEATS4
Entrez
Uniprot