Galectin-8 Recombinant Protein Antigen

Images

 
There are currently no images for Galectin-8 Protein (NBP1-87317PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Galectin-8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LGALS8.

Source: E. coli

Amino Acid Sequence: PFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LGALS8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87317.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Galectin-8 Recombinant Protein Antigen

  • GAL8
  • Gal-8
  • galectin 8
  • Galectin8
  • Galectin-8
  • galectin-8g
  • lectin, galactoside-binding, soluble, 8
  • LGALS8
  • PCTA1
  • PCTA-1Po66 carbohydrate-binding protein
  • Po66 carbohydrate binding protein
  • Po66-CBP
  • Prostate carcinoma tumor antigen 1

Background

Several proteins have been identified as specific markers of prostate cancer, and they may be useful as diagnostic indicators. PSA, prostate specific antigen, is the classical indicator for transformed prostate tissue; however, in addition to being upregulated in prostate cancer, PSA is also upregulated in non-malignant conditions, such as benign prostatic hyperplasia prostate. Galectin-8, also known as prostate-specific membrane antigen (PCTA-1), is an additional prostate-specific antigen that is overexpressed only in malignant tumors and therefore is a more specific identifier of malignancies. It is a member of the galectin gene family which mediates both cell-cell and cellmatrix interactions in a manner similar to the selectin subgroup of C-type lectins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1152
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF2045
Species: Hu
Applications: ICC, IHC, WB
AF1197
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF2128
Species: Mu
Applications: IHC, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-93653
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00001406-M02
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF1172
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
DKK300
Species: Hu
Applications: ELISA
MAB6210
Species: Hu
Applications: Simple Western, WB
AF1339
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NB200-323
Species: Hu, Rt
Applications: WB
NBP1-87317PEP
Species: Hu
Applications: AC

Publications for Galectin-8 Protein (NBP1-87317PEP) (0)

There are no publications for Galectin-8 Protein (NBP1-87317PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galectin-8 Protein (NBP1-87317PEP) (0)

There are no reviews for Galectin-8 Protein (NBP1-87317PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Galectin-8 Protein (NBP1-87317PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Galectin-8 Products

Research Areas for Galectin-8 Protein (NBP1-87317PEP)

Find related products by research area.

Blogs on Galectin-8

There are no specific blogs for Galectin-8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Galectin-8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LGALS8