GAL3ST3 Antibody - BSA Free

Western Blot: GAL3ST3 Antibody [NBP2-86643] - WB Suggested Anti-GAL3ST3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: MCF7 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GAL3ST3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GAL3ST3 Antibody - BSA Free (NBP2-86643) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAL3ST3. Peptide sequence: AHNTLAYDLGGDNERSPRDDAAYLAGLIRQVEEVFSLVMIAEYFDESLVL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAL3ST3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GAL3ST3 Antibody - BSA Free

• Beta-galactose-3-O-sulfotransferase 3
• EC 2.8.2.-
• GAL3ST2galactose 3'-sulfotransferase
• Gal3ST3
• GAL3ST-3
• galactose-3-O-sulfotransferase 3
• Gal-beta-1, 3-GalNAc 3'-sulfotransferase 3
• galbeta1-3GalNAc 3'-sulfotransferase 3
• MGC142112
• MGC142114

Background

The GAL3ST3 gene encodes a member of the galactose-3-O-sulfotransferase protein family. The product of this gene catalyzessulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2(Gal-beta-1-4GlcNAc-R) olig

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GAL3ST3