GAD1/GAD67 Antibody

Western Blot: GAD1/GAD67 Antibody [NBP2-34113] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: GAD1/GAD67 Antibody [NBP2-34113] - Staining of human cerebellum shows moderate positivity in Purkinje cells.

Immunohistochemistry-Paraffin: GAD1/GAD67 Antibody [NBP2-34113] - Analysis in human cerebral cortex and pancreas tissues. Corresponding GAD1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GAD1/GAD67 Antibody [NBP2-34113] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: GAD1/GAD67 Antibody [NBP2-34113] - Staining of human cerebral cortex shows strong positivity in neurons.

Product Discontinued

GAD1/GAD67 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRS
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GAD1/GAD67 Recombinant Protein Antigen (NBP2-34113PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GAD1/GAD67 Antibody

• 67kD)
• EC 4.1.1
• FLJ45882
• GAD1
• GAD25
• GAD67
• glutamate decarboxylase 1 (brain, 67kDa)
• Glutamate decarboxylase 67 kDa isoform

Background

Glutamic Acid Decarboxylase (GAD) catalyzes the conversion of glutamate to gamma-aminobutyric acid (GABA). There are two known forms of GAD; GAD65 (65 kDa) and GAD67 (67 kDa) that are encoded by two different genes and appear to have distinct intraneuronal distribution in the brain. This antibody reacts with GAD67 and is predicted to react with GAD65.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GAD1
• Uniprot:
  • Q99259()