We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GABPB1 Recombinant Protein Antigen

Images

 
There are currently no images for GABPB1 Recombinant Protein Antigen (NBP2-55876PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GABPB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GABPB1.

Source: E. coli

Amino Acid Sequence: ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GABPB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55876.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GABPB1 Recombinant Protein Antigen

  • E4TF1
  • E4TF1-47
  • E4TF1-53
  • E4TF1BBABPB2
  • GA binding protein transcription factor, beta subunit 1
  • GA binding protein transcription factor, beta subunit 2
  • GA-binding protein subunit beta-1
  • GABP subunit beta-1
  • GABPB-1
  • GABPB2
  • GABPB-2
  • GABPBGABP subunit beta-2
  • NRF2B1
  • NRF2B2
  • Nuclear respiratory factor 2
  • Transcription factor E4TF1-47
  • Transcription factor E4TF1-53

Background

GABPB1 encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32105
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-71648
Species: Hu, Mu(-)
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
3047-CC
Species: Hu
Applications: BA
DPSG10
Species: Hu
Applications: ELISA
NBP1-89125
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-20932
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-47447
Species: Hu, Rt
Applications: ELISA, IHC, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-88866
Species: Hu
Applications: IHC,  IHC-P
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
212-GD
Species: Hu
Applications: Bind, BA
1310-SE
Species: Hu
Applications: EnzAct
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-55876PEP
Species: Hu
Applications: AC

Publications for GABPB1 Recombinant Protein Antigen (NBP2-55876PEP) (0)

There are no publications for GABPB1 Recombinant Protein Antigen (NBP2-55876PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABPB1 Recombinant Protein Antigen (NBP2-55876PEP) (0)

There are no reviews for GABPB1 Recombinant Protein Antigen (NBP2-55876PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GABPB1 Recombinant Protein Antigen (NBP2-55876PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GABPB1 Products

Blogs on GABPB1

There are no specific blogs for GABPB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GABPB1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GABPB1