GABA-A R beta 1 Recombinant Protein Antigen

Images

 
There are currently no images for GABA-A R beta 1 Protein (NBP2-14034PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GABA-A R beta 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GABRB1.

Source: E. coli

Amino Acid Sequence: IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GABRB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14034.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GABA-A R beta 1 Recombinant Protein Antigen

  • GABA A R beta 1
  • GABA(A) receptor subunit beta-1
  • GABAAR beta 1
  • GABAARb1
  • GABRB1
  • gamma-aminobutyric acid (GABA) A receptor, beta 1
  • gamma-aminobutyric acid receptor subunit beta-1

Background

GABA (A) receptors are ligand-gated chloride channels that play a role as inhibitory neurotransmitters. They are known targets for certain classes of environmental and pharmaceutical compounds because a number of drugs interact with binding sites on GABA (A). Some of these drugs include benzodiazepines, anticonvulsants, and anesthetics. GABA (A) Receptors are comprised of subunits and these are further classified into 3 major groups (alpha, beta, and gamma). The subunits determine the pharmacological characteristics.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59326
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB300-199
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-59325
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB300-198
Species: Mu, Rt
Applications: WB
NBP2-75497
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91003
Species: Hu, Tr
Applications: IHC,  IHC-P
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB300-191
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
AF1705
Species: Mu
Applications: IHC, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
AF2796
Species: Hu
Applications: IHC, WB
NBP3-05546
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
AF1062
Species: Mu
Applications: Flow, IHC, Neut, WB
NBP3-48739
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-196
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for GABA-A R beta 1 Protein (NBP2-14034PEP) (0)

There are no publications for GABA-A R beta 1 Protein (NBP2-14034PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-A R beta 1 Protein (NBP2-14034PEP) (0)

There are no reviews for GABA-A R beta 1 Protein (NBP2-14034PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GABA-A R beta 1 Protein (NBP2-14034PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GABA-A R beta 1 Products

Research Areas for GABA-A R beta 1 Protein (NBP2-14034PEP)

Find related products by research area.

Blogs on GABA-A R beta 1

There are no specific blogs for GABA-A R beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GABA-A R beta 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GABRB1