Recombinant Human GABA-A R beta 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GABA-A R beta 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-109 of Human GABRB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TNEPSNMPYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GABRB1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GABA-A R beta 1 Protein

  • GABA A R beta 1
  • GABA(A) receptor subunit beta-1
  • GABAAR beta 1
  • GABAARb1
  • GABRB1
  • gamma-aminobutyric acid (GABA) A receptor, beta 1
  • gamma-aminobutyric acid receptor subunit beta-1

Background

GABRB1 - gamma-aminobutyric acid (GABA) A receptor, beta 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPS025
Species: Hu, Mu, Rt, Bv, Ca, Pm, Ze
Applications: WB
NB300-199
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IF, IHC-FrFl
NBP2-36560
Species: Mu, Rt
Applications: WB, IHC
NB300-198
Species: Mu, Rt
Applications: WB
NB300-195
Species: Mu, Rt
Applications: WB, IHC
NBP1-91003
Species: Hu, Tr
Applications: IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NB300-191
Species: Hu, Mu, Rt
Applications: WB
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
1705-HH/CF
Species: Hu, Mu
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2796
Species: Hu
Applications: WB, IHC
H00006532-M06
Species: Hu
Applications: ELISA, IP
AF1062
Species: Mu
Applications: WB, IHC, Neut
H00001815-R02
Species: Hu
NB300-196
Species: Mu, Rt
Applications: WB, ICC/IF
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE

Publications for GABA-A R beta 1 Partial Recombinant Protein (H00002560-Q01) (0)

There are no publications for GABA-A R beta 1 Partial Recombinant Protein (H00002560-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-A R beta 1 Partial Recombinant Protein (H00002560-Q01) (0)

There are no reviews for GABA-A R beta 1 Partial Recombinant Protein (H00002560-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GABA-A R beta 1 Partial Recombinant Protein (H00002560-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GABA-A R beta 1 Products

Bioinformatics Tool for GABA-A R beta 1 Partial Recombinant Protein (H00002560-Q01)

Discover related pathways, diseases and genes to GABA-A R beta 1 Partial Recombinant Protein (H00002560-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABA-A R beta 1 Partial Recombinant Protein (H00002560-Q01)

Discover more about diseases related to GABA-A R beta 1 Partial Recombinant Protein (H00002560-Q01).
 

Pathways for GABA-A R beta 1 Partial Recombinant Protein (H00002560-Q01)

View related products by pathway.

Research Areas for GABA-A R beta 1 Partial Recombinant Protein (H00002560-Q01)

Find related products by research area.

Blogs on GABA-A R beta 1

There are no specific blogs for GABA-A R beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GABA-A R beta 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GABRB1
Entrez