We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GAB2 Recombinant Protein Antigen

Images

 
There are currently no images for GAB2 Protein (NBP1-81500PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GAB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GAB2.

Source: E. coli

Amino Acid Sequence: LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GAB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81500.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GAB2 Recombinant Protein Antigen

  • GAB2
  • GRB2-associated binding protein 2
  • GRB2-associated-binding protein 2
  • Growth factor receptor bound protein 2-associated protein 2
  • KIAA0571GRB2-associated binder 2
  • p100
  • pp100

Background

Gab2 (Grb2-associated binder-2) is an adaptor protein involved in numerous intracellular signaling pathways via its interaction with receptor tyrosine kinases (RTKs), growth factors and cytokines. Gab2 is a substrate of various RTKs, including EGFR, insulin receptor, cytokine receptors as well as B and T cell antigen receptors; Gab2 acts as a docking protein for several SH2-containing proteins (1-3). Upon tyrosine phosphorylation, Gab2 interacts with SHP2 tyrosine phosphatase and GRB2 adaptor protein PI3-kinase, CrkL and SHC (4-5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF3790
Applications: ICC, Simple Western, WB
AF1230
Applications: IHC, KO, WB
NB100-866
Species: Hu, Mu, Po, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-37742
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP3-35867
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF467
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF2685
Applications: IHC, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NBP1-88650
Species: Hu
Applications:  IHC-P, KD, WB
NBP2-34136
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-67058
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-90078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB

Publications for GAB2 Protein (NBP1-81500PEP) (0)

There are no publications for GAB2 Protein (NBP1-81500PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAB2 Protein (NBP1-81500PEP) (0)

There are no reviews for GAB2 Protein (NBP1-81500PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GAB2 Protein (NBP1-81500PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GAB2 Products

Research Areas for GAB2 Protein (NBP1-81500PEP)

Find related products by research area.

Blogs on GAB2.

CD19: An Undoubted Biomarker for B Cells
CD19 is a cell surface protein member of the large immunoglobulin superfamily that complexes with CD21, CD81, and CD225 in the membrane of mature B-cells. A major function of CD19 is to assemble with the antigen receptor of B-lymphocytes to decrease t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GAB2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GAB2