G gamma7 Antibody - BSA Free

Western Blot: G gamma7 Antibody [NBP3-35093] - Western blot analysis of various lysates using G gamma7 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

G gamma7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit G gamma7 Antibody - BSA Free (NBP3-35093) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human G gamma7 (NP_443079.1).
  
  Sequence:
  MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNG7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 8 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for G gamma7 Antibody - BSA Free

• FLJ00058
• GNGT7
• guanine nucleotide binding protein (G protein), gamma 7
• guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7

Background

GNG7( AAH14466, 1 a.a. - 69 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNG7