![Western Blot: G gamma7 Antibody [H00002788-D01P] - Analysis of GNG7 expression in transfected 293T cell line by GNG7 polyclonal antibody.Lane 1: GNG7 transfected lysate(7.50 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/G-gamma7-Antibody-Western-Blot-H00002788-D01P-img0003.jpg "Western Blot: G gamma7 Antibody [H00002788-D01P] - Analysis of GNG7 expression in transfected 293T cell line by GNG7 polyclonal antibody.Lane 1: GNG7 transfected lysate(7.50 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Func |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | GNG7 (NP_443079.1, 1 a.a. - 68 a.a.) full-length human protein. MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL |
| Specificity | GNG7 - guanine nucleotide binding protein (G protein), gamma 7, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GNG7 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
![Immunohistochemistry MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Immunohistochemistry_19508.jpg)
![Western Blot MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Western_Blot_19525.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GNG7 |
| Entrez |
|
| Uniprot |
|
![Proximity Ligation Assay: G gamma7 Antibody [H00002788-D01P] - Analysis of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with anti-GNG7 rabbit purified polyclonal 1:1200 and anti-GNB5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/fullsize/G-gamma7-Antibody-Proximity-Ligation-Assay-H00002788-D01P-img0002.jpg "Proximity Ligation Assay: G gamma7 Antibody [H00002788-D01P] - Analysis of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with anti-GNG7 rabbit purified polyclonal 1:1200 and anti-GNB5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).")
![Western Blot Neurogranin Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogranin_AF7947_Western_Blot_13010.jpg)
![Immunohistochemistry Neurogranin Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogranin_AF7947_Immunohistochemistry_14734.jpg)
![ELISA Neurogranin Antibody [Unconjugated]](https://images.novusbio.com/images2/af7947_human-mouse-rat-neurogranin-affinity-purified-polyclonal-ab-elisa-27102022104024.jpg)
![Immunohistochemistry TSG Antibody [Unconjugated]](https://images.novusbio.com/images2/TSG_AF756_Immunohistochemistry_6896.jpg)
![Immunohistochemistry TSG Antibody [Unconjugated]](https://images.novusbio.com/images2/TSG_AF756_Immunohistochemistry_9970.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")