G gamma7 Antibody

Images

 
Western Blot: G gamma7 Antibody [H00002788-D01P] - Analysis of GNG7 expression in transfected 293T cell line by GNG7 polyclonal antibody.Lane 1: GNG7 transfected lysate(7.50 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: G gamma7 Antibody [H00002788-D01P] - Analysis of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with anti-GNG7 rabbit purified polyclonal 1:1200 and anti-GNB5 mouse ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

G gamma7 Antibody Summary

Immunogen
GNG7 (NP_443079.1, 1 a.a. - 68 a.a.) full-length human protein. MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
Specificity
GNG7 - guanine nucleotide binding protein (G protein), gamma 7,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNG7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for G gamma7 Antibody

  • FLJ00058
  • GNGT7
  • guanine nucleotide binding protein (G protein), gamma 7
  • guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-39474
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
AF756
Species: Mu
Applications: WB, IHC
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00000259-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-83060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82660
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52737
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF163
Species: Hu, Mu, Rt
Applications: WB, IHC
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-15667
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46641
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for G gamma7 Antibody (H00002788-D01P) (0)

There are no publications for G gamma7 Antibody (H00002788-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G gamma7 Antibody (H00002788-D01P) (0)

There are no reviews for G gamma7 Antibody (H00002788-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G gamma7 Antibody (H00002788-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G gamma7 Products

Bioinformatics Tool for G gamma7 Antibody (H00002788-D01P)

Discover related pathways, diseases and genes to G gamma7 Antibody (H00002788-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G gamma7 Antibody (H00002788-D01P)

Discover more about diseases related to G gamma7 Antibody (H00002788-D01P).
 

Pathways for G gamma7 Antibody (H00002788-D01P)

View related products by pathway.

PTMs for G gamma7 Antibody (H00002788-D01P)

Learn more about PTMs related to G gamma7 Antibody (H00002788-D01P).

Blogs on G gamma7

There are no specific blogs for G gamma7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G gamma7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNG7
Entrez
Uniprot