FVT1 Antibody - BSA Free

Western Blot: FVT1 Antibody [NBP3-10588] - Western blot analysis of FVT1 in PANC1 Whole cell lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FVT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FVT1 Antibody - BSA Free (NBP3-10588) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human FVT1 (NP_002026.1). Peptide sequence KKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCA
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KDSR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FVT1 Antibody - BSA Free

• 3-ketodihydrosphingosine reductase
• DHSR
• EC 1.1.1.102,3-dehydrosphinganine reductase
• FLJ36555
• FLJ92680
• follicular lymphoma variant translocation 1
• Follicular variant translocation protein 1
• FVT-1
• FVT1KDS reductase
• SDR35C1
• short chain dehydrogenase/reductase family 35C, member 1

Background

The protein encoded by the FVT1 gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KDSR