FUT9 Antibody

Immunocytochemistry/Immunofluorescence: FUT9 Antibody [NBP2-57960] - Staining of human cell line MCF7 shows localization to nucleoplasm, microtubules & cytokinetic bridge. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FUT9 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FUT9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FUT9 Recombinant Protein Antigen (NBP2-57960PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FUT9 Antibody

• Alpha-(1,3)-Fucosyltransferase 9
• alpha-(1,3)-fucosyltransferase
• EC 2.4.1
• EC 2.4.1.-
• EC 2.4.1.65
• fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
• Fucosyltransferase 9
• Fucosyltransferase IX
• FucT-IX
• Fuc-TIXFucT-IX
• FUT9
• Galactoside 3-L-fucosyltransferase

Background

FUT9 - fucosyltransferase 9 (alpha (1,3) fucosyltransferase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FUT9