FUT9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FUT9 Antibody [NBP2-57960] - Staining of human cell line MCF7 shows localization to nucleoplasm, microtubules & cytokinetic bridge.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FUT9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF
Specificity
Specificity of human FUT9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FUT9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FUT9 Recombinant Protein Antigen (NBP2-57960PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FUT9 Antibody

  • Alpha-(1,3)-Fucosyltransferase 9
  • alpha-(1,3)-fucosyltransferase
  • EC 2.4.1
  • EC 2.4.1.-
  • EC 2.4.1.65
  • fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
  • Fucosyltransferase 9
  • Fucosyltransferase IX
  • FucT-IX
  • Fuc-TIXFucT-IX
  • FUT9
  • Galactoside 3-L-fucosyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55006
Species: Hu
Applications: ICC/IF
BBA16
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
4949-GT
Species: Hu
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
7268-CT
AF5924
Species: Hu
Applications: WB, Simple Western
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
MAB161
Species: Hu
Applications: WB, Flow, IHC, AdBlk, CyTOF-ready, ICC
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31237
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for FUT9 Antibody (NBP2-57960) (0)

There are no publications for FUT9 Antibody (NBP2-57960).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUT9 Antibody (NBP2-57960) (0)

There are no reviews for FUT9 Antibody (NBP2-57960). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FUT9 Antibody (NBP2-57960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FUT9 Antibody (NBP2-57960)

Discover related pathways, diseases and genes to FUT9 Antibody (NBP2-57960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUT9 Antibody (NBP2-57960)

Discover more about diseases related to FUT9 Antibody (NBP2-57960).
 

Pathways for FUT9 Antibody (NBP2-57960)

View related products by pathway.

PTMs for FUT9 Antibody (NBP2-57960)

Learn more about PTMs related to FUT9 Antibody (NBP2-57960).

Blogs on FUT9

There are no specific blogs for FUT9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FUT9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FUT9
Entrez