FUSIP1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

FUSIP1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SRSF10.
  
  

  Source: E. coli

  Amino Acid Sequence: DRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSR

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SRSF10
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46815.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FUSIP1 Recombinant Protein Antigen

• 40 kDa SR-repressor protein
• FLJ43846
• FUS interacting protein (serine-arginine rich) 1
• FUS-interacting protein (serine-arginine rich) 2
• FUS-interacting serine-arginine-rich protein 1
• FUSIP1DKFZp686H0644
• FUSIP2
• neural-salient SR protein
• NSSR
• serine/arginine-rich splicing factor 10
• serine-arginine repressor protein (40 kDa)
• SFRS13
• SFRS13A
• Splicing factor SRp38
• splicing factor, arginine/serine-rich 13
• Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats
• SR splicing factor 10
• SRp38
• SRrp40TLS-associated protein with SR repeats
• TASR1TLS-associated SR protein
• TASR2FUS interacting protein (serine/arginine-rich) 1
• TASRFLJ30749
• TLS-associated protein TASR
• TLS-associated serine-arginine protein 1
• TLS-associated serine-arginine protein 2
• TLS-associated serine-arginine protein

Background

FUSIP1 product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing. Alternative splicing of this gene results in at least two transcript variants encoding different isoforms. In addition, transcript variants utilizing alternative polyA sites exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SRSF10