FUS2 Antibody - BSA Free

Immunohistochemistry-Paraffin: FUS2 Antibody [NBP1-89812] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FUS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FUS2 Antibody - BSA Free (NBP1-89812) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAA80
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FUS2 Protein (NBP1-89812PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FUS2 Antibody - BSA Free

• FUS-2
• FUS2EC 2.3.1.-
• N-acetyltransferase 6 (GCN5-related)
• N-acetyltransferase 6
• Protein fus-2
• Protein fusion-2

Background

Vertebrate FUS2 genes, which are known to be putative tumor suppressor gene, contain several important domains such as the catalytic N-acetyltransferase (NAT) domain. NAT domain is essential enzymes involved in several sophisticated cellular processes such as N-acetylation, O-acetylatin. NAT enzymes may be involved in susceptibility to cancer including colorectal cancer because of the presence of carcinogenic heterocyclic amines in some cooked foods. FUS2 was physically localized to the cytoplasm. Also, FUS2 showed the actin dependent movement, closely related to the polarization in the budding yeast, Saccharomyces cerevisiae.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAA80