FUBI/MNSF beta/FAU Antibody


Western Blot: FUBI/MNSF beta/FAU Antibody [NBP2-32413] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: FUBI/MNSF beta/FAU Antibody [NBP2-32413] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli, cytosol & endoplasmic reticulum.
Immunohistochemistry-Paraffin: FUBI/MNSF beta/FAU Antibody [NBP2-32413] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

FUBI/MNSF beta/FAU Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN
Specificity of human FUBI/MNSF beta/FAU antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Appendix Lysate (NB820-59172)
Control Peptide
FUBI/MNSF beta/FAU Protein (NBP2-32413PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FUBI/MNSF beta/FAU Antibody

  • 40S Ribosomal Protein S30
  • asr1
  • FAU
  • FAU1
  • FAU-encoded ubiquitin-like protein
  • FBR-MuSV-associated ubiquitously expressed
  • Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
  • Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed(fox derived)
  • FLJ22986
  • Fub1
  • FUBI
  • MNSFbeta
  • monoclonal nonspecific suppressor factor beta
  • ribosomal protein S30
  • RPS30
  • S30
  • ubiquitin-like protein fubi and ribosomal protein S30
  • ubiquitin-like-S30 fusion protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for FUBI/MNSF beta/FAU Antibody (NBP2-32413) (0)

There are no publications for FUBI/MNSF beta/FAU Antibody (NBP2-32413).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUBI/MNSF beta/FAU Antibody (NBP2-32413) (0)

There are no reviews for FUBI/MNSF beta/FAU Antibody (NBP2-32413). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FUBI/MNSF beta/FAU Antibody (NBP2-32413) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional FUBI/MNSF beta/FAU Products

Bioinformatics Tool for FUBI/MNSF beta/FAU Antibody (NBP2-32413)

Discover related pathways, diseases and genes to FUBI/MNSF beta/FAU Antibody (NBP2-32413). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUBI/MNSF beta/FAU Antibody (NBP2-32413)

Discover more about diseases related to FUBI/MNSF beta/FAU Antibody (NBP2-32413).

Pathways for FUBI/MNSF beta/FAU Antibody (NBP2-32413)

View related products by pathway.

PTMs for FUBI/MNSF beta/FAU Antibody (NBP2-32413)

Learn more about PTMs related to FUBI/MNSF beta/FAU Antibody (NBP2-32413).

Blogs on FUBI/MNSF beta/FAU

There are no specific blogs for FUBI/MNSF beta/FAU, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FUBI/MNSF beta/FAU Antibody and receive a gift card or discount.


Gene Symbol FAU