FUBI/MNSF beta/FAU Antibody

Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - MCF7, Antibody Dilution: 1.0 ug/ml FAU is supported by BioGPS gene expression data to be expressed in MCF7.

Immunohistochemistry: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - Human Adult liver Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 secProtocol located in Reviews and Data.

Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - Antibody Titration: 1 ug/ml Human liver.

Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - Jurkat, Antibody Dilution: 1.0 ug/ml FAU is supported by BioGPS gene expression data to be expressed in Jurkat.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FUBI/MNSF beta/FAU Antibody Summary

• Immunogen: Synthetic peptides corresponding to FAU(Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed) The peptide sequence was selected from the middle region of FAU. Peptide sequence VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAU
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:100-1:200
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against FAU and was validated on Western blot.
• Theoretical MW: 14 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FUBI/MNSF beta/FAU Antibody

• 40S Ribosomal Protein S30
• asr1
• FAU
• FAU1
• FAU-encoded ubiquitin-like protein
• FBR-MuSV-associated ubiquitously expressed
• Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
• Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed(fox derived)
• FLJ22986
• Fub1
• FUBI
• MNSFbeta
• monoclonal nonspecific suppressor factor beta
• ribosomal protein S30
• RPS30
• S30
• ubiquitin-like protein fubi and ribosomal protein S30
• ubiquitin-like-S30 fusion protein

Background

FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome.This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FUBI/MNSF beta/FAU Antibody (NBP1-55090)(1)

Publication using NBP1-55090

• Martin B, Chadwick W, Janssens J et al. GIT2 Acts as a Systems-Level Coordinator of Neurometabolic Activity and Pathophysiological Aging. Front Endocrinol (Lausanne) 2015 [PMID: 26834700]

Bioinformatics

• Gene Symbol: FAU
• Uniprot:
  • P62861(Human)