FUBI/MNSF beta/FAU Antibody

Images

 
Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - MCF7, Antibody Dilution: 1.0 ug/ml FAU is supported by BioGPS gene expression data to be expressed in MCF7.
Immunohistochemistry: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - Human Adult liver Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody ...read more
Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - Antibody Titration: 1 ug/ml Human liver.
Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - Jurkat, Antibody Dilution: 1.0 ug/ml FAU is supported by BioGPS gene expression data to be expressed in Jurkat.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FUBI/MNSF beta/FAU Antibody Summary

Immunogen
Synthetic peptides corresponding to FAU(Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed) The peptide sequence was selected from the middle region of FAU. Peptide sequence VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAU
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:100-1:200
Application Notes
This is a rabbit polyclonal antibody against FAU and was validated on Western blot.
Theoretical MW
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-55090.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FUBI/MNSF beta/FAU Antibody

  • 40S Ribosomal Protein S30
  • asr1
  • FAU
  • FAU1
  • FAU-encoded ubiquitin-like protein
  • FBR-MuSV-associated ubiquitously expressed
  • Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
  • Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed(fox derived)
  • FLJ22986
  • Fub1
  • FUBI
  • MNSFbeta
  • monoclonal nonspecific suppressor factor beta
  • ribosomal protein S30
  • RPS30
  • S30
  • ubiquitin-like protein fubi and ribosomal protein S30
  • ubiquitin-like-S30 fusion protein

Background

FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome.This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13263
Species: Hu
Applications: WB, IHC, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-33680
Species: Hu
Applications: IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-22289
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-80804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2682
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready, IF
NBP2-61764
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for FUBI/MNSF beta/FAU Antibody (NBP1-55090)(1)

Reviews for FUBI/MNSF beta/FAU Antibody (NBP1-55090) (0)

There are no reviews for FUBI/MNSF beta/FAU Antibody (NBP1-55090). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FUBI/MNSF beta/FAU Antibody (NBP1-55090) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FUBI/MNSF beta/FAU Products

Bioinformatics Tool for FUBI/MNSF beta/FAU Antibody (NBP1-55090)

Discover related pathways, diseases and genes to FUBI/MNSF beta/FAU Antibody (NBP1-55090). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUBI/MNSF beta/FAU Antibody (NBP1-55090)

Discover more about diseases related to FUBI/MNSF beta/FAU Antibody (NBP1-55090).
 

Pathways for FUBI/MNSF beta/FAU Antibody (NBP1-55090)

View related products by pathway.

PTMs for FUBI/MNSF beta/FAU Antibody (NBP1-55090)

Learn more about PTMs related to FUBI/MNSF beta/FAU Antibody (NBP1-55090).

Blogs on FUBI/MNSF beta/FAU

There are no specific blogs for FUBI/MNSF beta/FAU, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FUBI/MNSF beta/FAU Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAU
Uniprot