FUBI/MNSF beta/FAU Antibody


Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - MCF7, Antibody Dilution: 1.0 ug/ml FAU is supported by BioGPS gene expression data to be expressed in MCF7.
Immunohistochemistry: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - Human Adult liver Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody ...read more
Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - Antibody Titration: 1 ug/ml Human liver.
Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - Jurkat, Antibody Dilution: 1.0 ug/ml FAU is supported by BioGPS gene expression data to be expressed in Jurkat.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC
0.5 mg/ml

Order Details

FUBI/MNSF beta/FAU Antibody Summary

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Synthetic peptides corresponding to FAU(Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed) The peptide sequence was selected from the middle region of FAU. Peptide sequence VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS The peptide sequence for this immunogen was taken from within the described region.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:100-1:200
  • Western Blot 1.0 ug/ml
Theoretical MW
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using NBP1-55090.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
0.5 mg/ml
Affinity purified

Alternate Names for FUBI/MNSF beta/FAU Antibody

  • 40S Ribosomal Protein S30
  • asr1
  • FAU
  • FAU1
  • FAU-encoded ubiquitin-like protein
  • FBR-MuSV-associated ubiquitously expressed
  • Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
  • Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed(fox derived)
  • FLJ22986
  • Fub1
  • FUBI
  • MNSFbeta
  • monoclonal nonspecific suppressor factor beta
  • ribosomal protein S30
  • RPS30
  • S30
  • ubiquitin-like protein fubi and ribosomal protein S30
  • ubiquitin-like-S30 fusion protein


FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome.This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: Flow, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB

Publications for FUBI/MNSF beta/FAU Antibody (NBP1-55090)(1)

Reviews for FUBI/MNSF beta/FAU Antibody (NBP1-55090) (0)

There are no reviews for FUBI/MNSF beta/FAU Antibody (NBP1-55090). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FUBI/MNSF beta/FAU Antibody (NBP1-55090) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FUBI/MNSF beta/FAU Products

Diseases for FUBI/MNSF beta/FAU Antibody (NBP1-55090)

Discover more about diseases related to FUBI/MNSF beta/FAU Antibody (NBP1-55090).

Pathways for FUBI/MNSF beta/FAU Antibody (NBP1-55090)

View related products by pathway.

PTMs for FUBI/MNSF beta/FAU Antibody (NBP1-55090)

Learn more about PTMs related to FUBI/MNSF beta/FAU Antibody (NBP1-55090).

Blogs on FUBI/MNSF beta/FAU

There are no specific blogs for FUBI/MNSF beta/FAU, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FUBI/MNSF beta/FAU Antibody and receive a gift card or discount.


Gene Symbol FAU