FTSJD2 Recombinant Protein Antigen

Images

 
There are currently no images for FTSJD2 Protein (NBP1-83046PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FTSJD2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FTSJD2.

Source: E.coli

Amino Acid Sequence: DDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FTSJD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83046.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for FTSJD2 Recombinant Protein Antigen

  • Cap1 2'O-ribose methyltransferase 1
  • cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
  • EC 2.1.1.57
  • FtsJ methyltransferase domain containing 2
  • FtsJ methyltransferase domain-containing protein 2
  • hMTr1
  • Interferon-stimulated gene 95 kDa protein
  • ISG95
  • KIAA0082FLJ22156
  • MTR1
  • S-adenosyl-L-methionine-dependent methyltransferase FTSJD2

Background

KIAA0082 was first identified as a hypothetical protein predicted from the in silico analysis of long cDNAs isolated in the Kazusa cDNA sequencing project. KIAA0082 contains a G-patch and WW domain and several predicted phosphoserine sites.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30572
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86644
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
AF4599
Species: Hu
Applications: IHC, IP, Simple Western, WB
NB100-56176
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
MAB4158
Species: Hu
Applications: IHC
NLS32
Species: Bt, Bv, Ca, Eq, Hu, Pm, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-88493
Species: Hu
Applications: IHC, IHC-P, WB
NB100-65805
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-58415
Species: Hu
Applications: IHC, IHC-P
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85637
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-48318
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
6509-CA
Species: Hu
Applications: BA
NBP1-85838
Species: Hu
Applications: IHC, IHC-P
7268-CT
Species: Hu
Applications: BA
NBP1-82018
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83046PEP
Species: Hu
Applications: AC

Publications for FTSJD2 Protein (NBP1-83046PEP) (0)

There are no publications for FTSJD2 Protein (NBP1-83046PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FTSJD2 Protein (NBP1-83046PEP) (0)

There are no reviews for FTSJD2 Protein (NBP1-83046PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FTSJD2 Protein (NBP1-83046PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FTSJD2 Products

Bioinformatics Tool for FTSJD2 Protein (NBP1-83046PEP)

Discover related pathways, diseases and genes to FTSJD2 Protein (NBP1-83046PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FTSJD2 Protein (NBP1-83046PEP)

View related products by pathway.

PTMs for FTSJD2 Protein (NBP1-83046PEP)

Learn more about PTMs related to FTSJD2 Protein (NBP1-83046PEP).

Blogs on FTSJD2

There are no specific blogs for FTSJD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FTSJD2 Antibody
NB100-79786

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FTSJD2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FTSJD2