![Western Blot: FSBP Antibody [NBP2-76996] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/FSBP-Antibody-Western-Blot-NBP2-76996-img0002.jpg "Western Blot: FSBP Antibody [NBP2-76996] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SNISEPTKKVMEMIPQISSFCLVRDRNHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FSBP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Dual RNAscope ISH-IHC: Von Willebrand Factor Antibody [NB600-586] - Formalin-fixed paraffin-embedded tissue sections of human metastatic tonsil were probed for vWF mRNA (ACD RNAScope probe, catalog # 5860461; Fast Red chromogen, ACD catalog # 322500). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal (Novus catalog # NB600-586) at 1:500 dilution for 1 hour at room temperature followed by incubation with the anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue).](http://images.novusbio.com/images2/Von-Willebrand-Factor-Antibody-Dual-RNAscope-ISH-IHC-NB600-586-img0007.jpg)
![Immunohistochemistry-Frozen: Von Willebrand Factor Antibody [NB600-586] - Canine brain/spinal cord. VWF antibody in green. A pericyte marker in red. Alexa Fluor conjugated secondary antibodies were used for visualization. IHC-Fr image submitted by a verified customer review.](http://images.novusbio.com/images2/Von-Willebrand-Factor-Antibody-Immunohistochemistry-Frozen-NB600-586-img0008.jpg)
![Immunohistochemistry: Von Willebrand Factor Antibody [NB600-586] - Formalin fixed paraffin embedded human tonsil stained with Factor VIII antibody.](http://images.novusbio.com/images2/Von-Willebrand-Factor-Antibody-Immunohistochemistry-NB600-586-img0001.jpg)
![Immunohistochemistry-Frozen: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.](http://images.novusbio.com/images2/beta-Amyloid-Antibody-(MOAB-2)-Immunohistochemistry-Frozen-NBP2-13075-img0018.jpg)
![Immunohistochemistry: beta Amyloid Antibody (MOAB-2) - BSA Free [NBP2-13075] - A plaque load in neocortex and hippocampus in APP/PS1 mice exposed to differential housing. Representative 10x MOAB-2 staining in hippocampus of APP/PS1 mice for each housing group. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28584278/) licensed under a CC-BY licence.](http://images.novusbio.com/images2/beta-Amyloid-Antibody-(MOAB-2)-Immunohistochemistry-NBP2-13075-img0019.jpg)
![Immunocytochemistry/Immunofluorescence: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Immunofluorescent detection of beta Amyloid with MOAB-2 in the subiculim of 1-, 2- and 4- month old 5xFAD mice. Scale bar 20 um (from PMID: 22423893).](http://images.novusbio.com/images2/beta-Amyloid-Antibody-(MOAB-2)-Immunocytochemistry-Immunofluorescence-NBP2-13075-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: APBA1 Antibody [NBP2-41182] - Human brain tissue with APBA1 antibody at 20 ug/mL.](http://images.novusbio.com/images2/APBA1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-41182-img0003.jpg)
![Western Blot: APBA1 Antibody [NBP2-41182] - Analysis of APBA1 in rat brain tissue lysate with APBA1 antibody at 0.5 ug/ml in (A) the absence and (B) the presence of blocking peptide.](http://images.novusbio.com/images2/APBA1-Antibody-Western-Blot-NBP2-41182-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: OXA1L Antibody [H00005018-D01P] - Analysis of antibody to OXA1L on HeLa cell. Antibody concentration 30 ug/ml.](http://images.novusbio.com/images2/OXA1L-Antibody-Immunocytochemistry-Immunofluorescence-H00005018-D01P-img0002.jpg)
![Western Blot: OXA1L Antibody [H00005018-D01P] - Analysis of OXA1L expression in HepG2.](http://images.novusbio.com/images2/OXA1L-Antibody-Western-Blot-H00005018-D01P-img0003.jpg)
![Western Blot: OXA1L Antibody [H00005018-D01P] - Analysis of OXA1L expression in transfected 293T cell line by OXA1L polyclonal antibody.Lane 1: OXA1L transfected lysate(48.50 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/OXA1L-Antibody-Western-Blot-H00005018-D01P-img0005.jpg)
![Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).](http://images.novusbio.com/images2/Tau-[p-Thr181]-Antibody-Western-Blot-NB100-82245-img0003.jpg)
![Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Analysis of extracts from mouse brain tissue using Tau(Phospho-Thr181) Antibody and the same antibody preincubated with blocking peptide.](http://images.novusbio.com/images2/Tau-[p-Thr181]-Antibody-Western-Blot-NB100-82245-img0001.jpg)
![Western Blot: Tau [p Thr181] Antibody [NB100-82245] - PPP2R2C level regulates Tau phosphatase levels. Representative image of immunoblots of indicated antibodies are shown in SHSY5Y cell lines after knockdown and overexpression PPP2R2C. Image collected and cropped by CiteAb from the following publication (www.aging-us.com/lookup/doi/10.18632/aging.103048) licensed under a CC-BY licence.](http://images.novusbio.com/images2/Tau-[p-Thr181]-Antibody-Western-Blot-NB100-82245-img0006.jpg)
![Flow Cytometry: GSK-3 beta Antibody (3D10) [NBP1-47470] - An intracellular stain was performed on HeLa cells with GSK-3 beta (3D10) antibody NBP1-47470PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.](http://images.novusbio.com/images2/GSK-3-beta-Antibody-(3D10)-Flow-Cytometry-NBP1-47470-img0013.jpg)
![Immunohistochemistry: GSK-3 beta Antibody (3D10) [NBP1-47470] - Fap1-inhibition with SLV peptide increases phosphorylation of Fap1-substrates Fas and GSK-3 beta in a murine xenograft model. SW620 cells injected into flanks of athymic Nude mice & tumor volume was checked biweekly. Mice treated weekly with oxaliplatin (days 0, 7 and 14) & injected daily with Fap1 blocking SLV peptide, VLS control peptide, or treated with SLV or VLS peptide alone (n=12). Tumors were simultaneously harvested when control tumors were >2,000 mm3. SLV peptide increases Gsk3-phosphorylation with/without oxaliplatin. IF detection of total versus phospho- GSK-3 beta performed with DAPI staining of nuclei (areas without gland formation were selected). Image collected and cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.25401), licensed under a CC-BY licence.](http://images.novusbio.com/images2/GSK-3-beta-Antibody-(3D10)-Immunohistochemistry-NBP1-47470-img0014.jpg)
![Simple Western: GSK-3 beta Antibody (3D10) [NBP1-47470] - Simple Western lane view shows a specific band for GSK-3 Beta in 0.5 mg/ml of Hek293 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/images2/GSK-3-beta-Antibody-(3D10)-Simple-Western-NBP1-47470-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/images2/Tight-Junction-Protein-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85047-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.](http://images.novusbio.com/images2/Tight-Junction-Protein-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85047-img0008.jpg)
![Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.](http://images.novusbio.com/images2/Tight-Junction-Protein-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85047-img0014.jpg)
![Flow Cytometry: GBA3 Antibody (1F1) [NBP2-00521] - Analysis of Hela cells, using anti-GBA3 antibody, (Red), compared to a nonspecific negative control antibody (Blue).](http://images.novusbio.com/images/GBA3-Antibody-(1F1)-Flow-Cytometry-NBP2-00521-img0001.jpg)
![Flow Cytometry: GBA3 Antibody (1F1) [NBP2-00521] - Analysis of Jurkat cells, using anti-GBA3 antibody, (Red), compared to a nonspecific negative control antibody (Blue).](http://images.novusbio.com/images/GBA3-Antibody-(1F1)-Flow-Cytometry-NBP2-00521-img0002.jpg)
![Flow Cytometry: GBA3 Antibody (1F1) [NBP2-00521] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GBA3 antibody, and then analyzed by flow cytometry.](http://images.novusbio.com/images/GBA3-Antibody-(1F1)-Flow-Cytometry-NBP2-00521-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for FSBP Antibody (NBP2-76996)Discover more about diseases related to FSBP Antibody (NBP2-76996).
| Pathways for FSBP Antibody (NBP2-76996)View related products by pathway.
|
PTMs for FSBP Antibody (NBP2-76996)Learn more about PTMs related to FSBP Antibody (NBP2-76996).
| Research Areas for FSBP Antibody (NBP2-76996)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: FSBP Antibody [NBP2-76996] - Staining of human duodenum shows general cytoplasmic positivity with additional nuclear staining.](http://images.novusbio.com/fullsize2/FSBP-Antibody-Immunohistochemistry-Paraffin-NBP2-76996-img0001.jpg "Immunohistochemistry-Paraffin: FSBP Antibody [NBP2-76996] - Staining of human duodenum shows general cytoplasmic positivity with additional nuclear staining.")
![Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/images2/Steroid-sulfatase-Antibody-Immunohistochemistry-Paraffin-NBP1-90095-img0004.jpg)
![Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining in human placenta and pancreas tissues using anti-STS antibody. Corresponding STS RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Steroid-sulfatase-Antibody-Immunohistochemistry-Paraffin-NBP1-90095-img0006.jpg)
![Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human placenta shows high expression.](http://images.novusbio.com/images2/Steroid-sulfatase-Antibody-Immunohistochemistry-Paraffin-NBP1-90095-img0005.jpg)
![Immunohistochemistry-Paraffin: CCAR1 Antibody [NB500-186] - Human stomach carcinoma (left) and mouse renal cell carcinoma (right). Antibody: Affinity purified rabbit anti-CCAR1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB](http://images.novusbio.com/images2/CCAR1-Antibody-Immunohistochemistry-Paraffin-NB500-186-img0004.jpg)
![Immunoprecipitation: CCAR1 Antibody [NB500-186] - Detection of human CCAR1 by western blot of immunoprecipitates. Samples: Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CCAR1 antibody NB500-186 (lot NB500-186-2) used for IP at 6 ug/mg lysate. CCAR1 was also immunoprecipitated by a previous lot (lot NB500-186-1) of the antibody. For blotting immunoprecipitated CCAR1, NB500-186 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.](http://images.novusbio.com/images2/CCAR1-Antibody-Immunoprecipitation-NB500-186-img0007.jpg)
![Western Blot: CCAR1 Antibody [NB500-186] - Necdin interacts with CCAR1/CARP1. Interaction of necdin and CCAR1 in C2C12 myoblasts and primary myoblast cells. Co-IP experiments were performed on protein extract from C2C12 transfected with pCMV-FLAG-Necdin (C2C12 pCMV-FLAG-Ndn) or primary myoblasts from C57/Bl6 newborn mice. Proteins were immunoprecipitated using the polyclonal anti-Ndn (alpha-Ndn) or polyclonal anti-CCAR1 (alpha-CCAR1) and with a non-specific rabbit antisera as control (IgG). Necdin and CCAR1 were detected in immunoprecipitated samples using specific antibody. Input (I) represents 10% of the immunoprecipitated proteins. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0043335), licensed under a CC-BY licence.](http://images.novusbio.com/images2/CCAR1-Antibody-Western-Blot-NB500-186-img0008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")